SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000000126 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000000126
Domain Number 1 Region: 541-584
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000126
Family Classic zinc finger, C2H2 0.0016
Further Details:      
 
Domain Number 2 Region: 573-612
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000773
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 3 Region: 506-556
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000313
Family Classic zinc finger, C2H2 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000000126   Gene: ENSORLG00000000102   Transcript: ENSORLT00000000126
Sequence length 614
Comment pep:novel chromosome:MEDAKA1:1:936408:945505:-1 gene:ENSORLG00000000102 transcript:ENSORLT00000000126 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CFEAEETDKQVSDKEGSMATTVAVSPSEYLQPSSASTQQDTQPSPLALLAATCSKIGPPA
AQAPVTSPPAQPQPRRLLPIKPAPIAPAPPKNMGFLSAKGNVIQLPAGLGSSAPGSPIVL
TIQQSPSRSSASGPANIQYQVVPQIQGPQTIQMMPQGGQIQLIPGTNQAIITAPMTVPAP
AAAAPVTPQKTVAIKPSLKAKKAASATVVQLPGGHTLPLNVATGEVGVAPILTETQASLT
APEKGRRGRKRKVVLPAEPPPPAPTQAASPTPDQMETILIEAGDNIIQAGNNLLIVQSPG
QPAVVQQVQLVQPKADSQLVQIPQQALKVVQAASATLPPVPQRQPVSPNLQTSPTEPTPT
QIIFKTATGEWQSVQLQESVSTVTTPTTSVAPAITSPSANAKKPGGKKERTLAKIAPAGG
MITFNASQLPSAAQAVQTISINGVQVQGVPVTITNTGGQQHLTVQTMQGGGLQLAPTQGQ
SAIQVEQTFTLELPSQPGEKKRRMACTCPNCKDADKRPGEVGKRRHICHVPGCEKTFRKT
SLLRAHVRLHTGERPFVCNWVYCGKRFTRSDELQRHARTHTGDKRFECSQCQKRFMRSDH
LTKHYKTHINTKNL
Download sequence
Identical sequences H2L320
ENSORLP00000000126 ENSORLP00000000126 8090.ENSORLP00000000126

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]