SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000000219 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSORLP00000000219
Domain Number - Region: 61-110
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000835
Family Classic zinc finger, C2H2 0.065
Further Details:      
 
Domain Number - Region: 24-47
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00171
Family Classic zinc finger, C2H2 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000000219   Gene: ENSORLG00000000180   Transcript: ENSORLT00000000219
Sequence length 337
Comment pep:known chromosome:MEDAKA1:3:3355887:3360220:-1 gene:ENSORLG00000000180 transcript:ENSORLT00000000219 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSSVNSVSVSAENGNEAGILRRDCPLSGCKRAYKDSISLQNHIKEHEIPAESVNGKVLL
CSTVGCSASFPSMQKLMVHTRLHHKPNIYFQCESCRTKLRSYRNLLGHLHTCSKVPRGKP
KAAEPATPMVKPAEQPSPQLEPLSSPQLTSFESTTPDRCVPAAFLSGPTDPPMLDPPVLP
LQEISPPNHPPTQLRETASPVPSESYYSLPPTLKPVTPKAVVDPPDLQSQVQTQTWTSEA
THPVSLPAVSSHGSPAVWRKSQGLGCSRRVLWEHTRGCYTCVQCGHRATNRKEMSEHISS
NHSGSRAAENRTTPPVLHAVSAPPKRPEEAGGSDAGK
Download sequence
Identical sequences H2L3A7
ENSORLP00000000219 ENSORLP00000000219 XP_004066848.1.28442 8090.ENSORLP00000000219

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]