SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000000236 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000000236
Domain Number 1 Region: 98-155
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.6e-25
Family Classic zinc finger, C2H2 0.0089
Further Details:      
 
Domain Number 2 Region: 43-99
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.04e-22
Family Classic zinc finger, C2H2 0.0079
Further Details:      
 
Domain Number 3 Region: 4-56
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.14e-17
Family Classic zinc finger, C2H2 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000000236   Gene: ENSORLG00000000197   Transcript: ENSORLT00000000236
Sequence length 168
Comment pep:novel chromosome:MEDAKA1:2:7338119:7338622:-1 gene:ENSORLG00000000197 transcript:ENSORLT00000000236 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SGEKPFSCEECDKSFSFVYNLKTHMKTHSGEKPFSCKECNKCYSYLSAFKMHVRTHTGEK
PFSCKECDKSFSYPSALKMHVRSHTGEKPFSCKECNKSFSSLSALKMHVRTHTGEKPFSC
KECDKSFNYKANLKTHMRTHTGEKPFLCVECDKSFRCGSNLKTHMRTH
Download sequence
Identical sequences H2L3B8
ENSORLP00000000236 8090.ENSORLP00000000236 ENSORLP00000000236

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]