SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000000237 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000000237
Domain Number 1 Region: 160-216
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.89e-22
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 2 Region: 111-160
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.93e-21
Family Classic zinc finger, C2H2 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000000237   Gene: ENSORLG00000000199   Transcript: ENSORLT00000000237
Sequence length 224
Comment pep:novel chromosome:MEDAKA1:2:7379593:7380732:1 gene:ENSORLG00000000199 transcript:ENSORLT00000000237 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QQRNFRVKHEEPEPPQIKEELDELCISQDEDQLDLKQETDTLMEIPTYKEDENSEADLNN
QQSFNVTDSQDEERNQHEESTSTTDEETDPQNRDQRKRRDRSHVQSADSSHIHMRSHTGE
KSFACEECDKSFSEISDLKRHMRTHTGEKSFVCEECGKSFGEIASLKKHMRTHTGEKPYP
CKECNTSFSRKSHLKTHMTTHTGEKPFTCKECDTSFSQTSSLKT
Download sequence
Identical sequences H2L3B9
8090.ENSORLP00000000237 ENSORLP00000000237 ENSORLP00000000237

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]