SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000000262 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000000262
Domain Number 1 Region: 228-287
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000136
Family Classic zinc finger, C2H2 0.0022
Further Details:      
 
Domain Number 2 Region: 189-241
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000524
Family Classic zinc finger, C2H2 0.0022
Further Details:      
 
Domain Number 3 Region: 104-132
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000398
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000000262
Domain Number - Region: 286-338
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00624
Family Classic zinc finger, C2H2 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000000262   Gene: ENSORLG00000000210   Transcript: ENSORLT00000000262
Sequence length 338
Comment pep:novel chromosome:MEDAKA1:8:322098:324995:-1 gene:ENSORLG00000000210 transcript:ENSORLT00000000262 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDTSWSNSSLTSQTAPTPNQPETQLQAELLPELSGPAQSPPEEQIIAPPSTVDTAALSEE
PLQGERRTRLSVLKHKKVSVIFKHDSPSLLRPPVKPLAKPLRPAHICATCNKEFKNSYNL
RRHQSVHTGIKMKDRAAREKEDVAKAARLEKPSIPLSLLQLTLPTQPPPAAPEALSQPGQ
LATQDEVRKNHACEACGKAFRDVYHLNRHRLSHSDEKPYSCPICQQRFKRKDRMSYHVRS
HQGGVEKPYICPHCAKAFSRPDHLNSHVRQVHSTERPFKCTTCTSAFATRDRLRAHLIRH
EEKVPCHICGKLLSAAYITDHMRVHNQSQHHSCHLCNR
Download sequence
Identical sequences H2L3E4
ENSORLP00000000262 8090.ENSORLP00000000262 ENSORLP00000000262

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]