SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000000311 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000000311
Domain Number 1 Region: 460-516
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.9e-21
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 2 Region: 390-442
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.46e-20
Family Classic zinc finger, C2H2 0.0061
Further Details:      
 
Domain Number 3 Region: 348-405
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.62e-20
Family Classic zinc finger, C2H2 0.0093
Further Details:      
 
Domain Number 4 Region: 68-125
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.24e-19
Family Classic zinc finger, C2H2 0.0087
Further Details:      
 
Domain Number 5 Region: 236-293
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.06e-18
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 6 Region: 8-62
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.24e-18
Family Classic zinc finger, C2H2 0.0086
Further Details:      
 
Domain Number 7 Region: 501-553
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.13e-18
Family Classic zinc finger, C2H2 0.0091
Further Details:      
 
Domain Number 8 Region: 293-349
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.4e-18
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 9 Region: 124-181
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.55e-17
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 10 Region: 166-218
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.35e-17
Family Classic zinc finger, C2H2 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000000311   Gene: ENSORLG00000000253   Transcript: ENSORLT00000000311
Sequence length 557
Comment pep:novel chromosome:MEDAKA1:2:13492827:13532017:-1 gene:ENSORLG00000000253 transcript:ENSORLT00000000311 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ECGRSCTTSKGLKRHIKIHTGEKPFSCKECSKSFSRNYRLTRHMSTHSEEKPFSCEECHK
SFRECKKSFRNSFHFKCHMLTHTGEKPFSCKKCNKTFSRKYHLTRHMSTHTDEKPFSCEE
CHKSFSHSVLLISHMSNHLKERRFSCTECNKSFRHIFDLKYHMLTHTGEKPFSCKLCSKS
FRRKYHLLRHTSTHSGEKPFSCKECHESFSQSSLLKSHMSTHSEEQQLSCTECNESFRHI
LDFKCHMLIHTGQKPFSCKECSKTFSRNYHLKRHMSTHSGEKPFSCTECHKRFGHSSFLK
CHMLIHTGEKRFSCTECNKRFKSISYLKCHMLTHTGEKPFSCKKCSKAFSRNSHLTRHMS
THTESKPYVCKECGKSFCFLSMFRIHVRSHTGEKLFVCKECGRSFSQKGNLKRHMRTHTG
EKPFSCKECDKRFNDISNLKAHMRNFTENPFFCKKCDRRFCNVSQFRYHIRIHTGEKRFL
CKECGRSFSQKGNIERHMRTHTGEKPFSCKECDKSFNDVSNLRTHMKKHTGERPFSCIKC
DKSFNRIYHLQRHIRTH
Download sequence
Identical sequences H2L3I8
ENSORLP00000000311 8090.ENSORLP00000000311 ENSORLP00000000311

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]