SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000000344 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000000344
Domain Number 1 Region: 5-275
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 4.27e-78
Family Eukaryotic proteases 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000000344   Gene: ENSORLG00000000282   Transcript: ENSORLT00000000344
Sequence length 307
Comment pep:novel chromosome:MEDAKA1:8:593533:596799:-1 gene:ENSORLG00000000282 transcript:ENSORLT00000000344 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKAAPLVLLWFSLSACPRVWPAVCGTAPLRKPHTRIIGGEDAPAGVWPWQASVHNNSTLC
GGSLISRRWVLTAARCLSSDADVVVFLGRDTQMGPNLHEVMRWVSKVIKHPDYDPGTHKN
DLALLRLSSPVNFTDYIRPVCLAAKRSFFVDGLSCWVTGWGAPQTNAPLPPPQRLQQVSV
PIVSNIQCNAAYGTGKVTNQDDVCRAGLQGQRLLRGERGRCRDGDFGGPLVVSYGNRWIQ
AGVASFVTGCGYPDYPGVYTRVSRYQTWINYHTGEEQPGYVYFWSSASRTSPFIAMFSLL
AAMALVF
Download sequence
Identical sequences H2L3L9
ENSORLP00000000344 ENSORLP00000000344 8090.ENSORLP00000000344

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]