SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000000351 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000000351
Domain Number 1 Region: 66-116
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000482
Family Classic zinc finger, C2H2 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000000351   Gene: ENSORLG00000000286   Transcript: ENSORLT00000000351
Sequence length 129
Comment pep:novel chromosome:MEDAKA1:11:225683:227215:-1 gene:ENSORLG00000000286 transcript:ENSORLT00000000351 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEMIKIEKVVVGRKTNTCEPLHTYRAESLQCFQCFITFSDSKSKERHMRKSHREQYMQHL
QQTNTLFICYKCDKCFFCPKELRQHQVTHTADEKPFVCTYCQKTFSIFSEFTKHRRYECA
LRGRFCKDC
Download sequence
Identical sequences H2L3M6
ENSORLP00000000351 ENSORLP00000000351 8090.ENSORLP00000000351

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]