SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000000396 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000000396
Domain Number 1 Region: 15-67
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.53e-19
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 2 Region: 56-110
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000152
Family Classic zinc finger, C2H2 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000000396   Gene: ENSORLG00000000326   Transcript: ENSORLT00000000396
Sequence length 198
Comment pep:novel chromosome:MEDAKA1:15:205748:210741:1 gene:ENSORLG00000000326 transcript:ENSORLT00000000396 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EDEEKKGKGREEDKLVEDEKVHTGEKPFSCAFPNCGKMFARSENLKIHTRTHTGEKPFQC
DFCERRFANSSDRKKHSQVHTASKPYDCKALGCTKSYTHPSSLRKHMKIHVKSSPPSDPQ
DLYNFLPHQLPPPHQAVLEPLDLKMNHFSPSLSNIKEWYVCTRTAVPHFPLLHPDHIKAE
RSSDEEYITNPETARTCR
Download sequence
Identical sequences H2L3R8
8090.ENSORLP00000000396 ENSORLP00000000396 ENSORLP00000000396

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]