SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000000405 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000000405
Domain Number 1 Region: 551-608
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.28e-24
Family Classic zinc finger, C2H2 0.0095
Further Details:      
 
Domain Number 2 Region: 160-216
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.05e-22
Family Classic zinc finger, C2H2 0.0083
Further Details:      
 
Domain Number 3 Region: 440-496
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.27e-22
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 4 Region: 215-272
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.17e-22
Family Classic zinc finger, C2H2 0.0083
Further Details:      
 
Domain Number 5 Region: 495-552
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.1e-22
Family Classic zinc finger, C2H2 0.008
Further Details:      
 
Domain Number 6 Region: 47-104
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.26e-22
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 7 Region: 327-384
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.82e-22
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 8 Region: 272-328
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.7e-22
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 9 Region: 383-440
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.77e-21
Family Classic zinc finger, C2H2 0.0087
Further Details:      
 
Domain Number 10 Region: 607-658
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.33e-21
Family Classic zinc finger, C2H2 0.0086
Further Details:      
 
Domain Number 11 Region: 103-160
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.38e-21
Family Classic zinc finger, C2H2 0.008
Further Details:      
 
Domain Number 12 Region: 9-61
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.52e-17
Family Classic zinc finger, C2H2 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000000405   Gene: ENSORLG00000000333   Transcript: ENSORLT00000000405
Sequence length 659
Comment pep:novel chromosome:MEDAKA1:2:14419425:14452388:-1 gene:ENSORLG00000000333 transcript:ENSORLT00000000405 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HKRIHKKGKHFACKECTKSFSNITYLKSHMRTHTGEKPFSCTECDTSFRQIAHLKSHMRT
HTGDKPFSCKECDKSFSQMHSLKRHMRTHTEEKPFSCQGCDKSFSQNNTLKAHMRTHTGE
KPFSCKECYRGFSHVSNLNIHMRTHTGEKPFSCKECYRGFTNVSSLKSHMRIHTGEKPFS
CKECDRSFSHICALKRHMRIHTGERPFSCKECDRSFTHICALKRHMRTHTGEKPFTCKEC
DARFSRIAYLKKHMRTHTGEKPFSCKECNKGFSHRSSLKTHMRTHTGDKRFSCKECDTSF
SYLSNLETHMRIHTGEKPFSCNKCDKSFSDITYLKSHMRTHTGEKPFSCTECDTSFRQIA
HLKSHMRTHTGDKPFSCKECDKSFSQMHSLKRHMRTHTEEKPFSCQGCDKSFSQNNTLKA
HMRTHTGEKPFSCKECYRGFSHVSNLNIHMRTHTGEKPFSCKECYRGFTNVSSLKSHMRI
HTGEKPFSCKECDRSFSHICALKRHMRIHTGERPFSCKRCDKSFSQNNTLKAHMRTHTGE
KPFSCNACDRSFSHVSNLNIHMRTHTGEKPFSCKECDRGFTNVSSLKIHMRIHTGEKPFS
CKECDRSFSHKYALKRHMRTHTGEKPFTCKECDASFSHRSSLKTHMRIHTGEKPFSCNK
Download sequence
Identical sequences H2L3S5
ENSORLP00000000405 8090.ENSORLP00000000405 ENSORLP00000000405

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]