SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000000481 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000000481
Domain Number 1 Region: 14-265
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 6.13e-83
Family Eukaryotic proteases 0.000000458
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000000481   Gene: ENSORLG00000000391   Transcript: ENSORLT00000000481
Sequence length 267
Comment pep:known chromosome:MEDAKA1:3:4160669:4162271:1 gene:ENSORLG00000000391 transcript:ENSORLT00000000481 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIEPWPSCGSSLASPLLVPPTGCGRPAISPIVTGYSRIVNGEEAVPHSWPWQASLQDWSG
FHFCGGSLINENWVVTAAHCNVRTSHYVILGEHDRNSNAENIQVLNVGQVFKHPQYNSYT
INNDILLIKLATPAQLNTRVSPVCVAETTDNFAGGMMCMTSGWGLTHHANANTPALLQQA
ALPLLTNANCSSYWGSNITDLMICAGASGASSCMGDSGGPLVCQKDGAWTLVGIVSWGSS
TCSTSMPGVYARVTKLRAWMDQTIAAN
Download sequence
Identical sequences H2L401
8090.ENSORLP00000000481 ENSORLP00000000481 ENSORLP00000000481

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]