SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000000537 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000000537
Domain Number 1 Region: 179-235
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.66e-23
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 2 Region: 293-347
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.19e-23
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 3 Region: 375-431
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.17e-22
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 4 Region: 41-94
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.22e-22
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 5 Region: 95-151
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.48e-22
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 6 Region: 446-506
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.04e-19
Family Classic zinc finger, C2H2 0.0083
Further Details:      
 
Domain Number 7 Region: 220-272
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000181
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 8 Region: 141-173
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000231
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 9 Region: 337-368
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000319
Family Classic zinc finger, C2H2 0.008
Further Details:      
 
Domain Number 10 Region: 3-52
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000475
Family Classic zinc finger, C2H2 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000000537   Gene: ENSORLG00000000436   Transcript: ENSORLT00000000537
Sequence length 508
Comment pep:novel chromosome:MEDAKA1:2:15398246:15424318:1 gene:ENSORLG00000000436 transcript:ENSORLT00000000537 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PRDCKECGESFGNLSQCRFHMKLHKKGKHFVCKVCNISCSKIANLKTHMRIHTGEKPFSC
KECDKSFSRNLNLKIHMRTHTGEKPFSCKECNRRYSDLSNLKTHMRTHTGEKPFSCKECD
IRFSQISCLKRHMITHTGEKPFQCKHCDKHFSRMGNLKTHIRTHTGEKPFSCKECDSRFS
DKSHLNKHMRTHTGEKPFTCKECDKSFSHTCNLKTHIRTHTGERPFSCKECDKSFHDLSN
LKKHIRSHTHNPPFYCKKCGKSFDNLSQFKFHMKLHKKGKHFVCEVCNRSCSKIANLITH
MKSHTGEKPFSCKECDKSFSRNINLQIHMRTHTGEKPYSCKECDKSFSLNLNLKTHMRTH
TGEKPFCCIECKRSYRDLSNFKKHIRTHTGEKPFSCNECDKSFSRKSHLKLHMRTHTGEK
PFHCKECDTHFSRMGNLKTHIRTHTGEKPFSCEECDSSFTDTSRLKKHMRKHTGEKPFTC
KECDKSFSDTCNLKRHIRTHTGERPFSC
Download sequence
Identical sequences H2L455
ENSORLP00000000537 8090.ENSORLP00000000537 ENSORLP00000000537

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]