SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000000642 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000000642
Domain Number 1 Region: 256-313
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.04e-24
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 2 Region: 594-650
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.52e-23
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 3 Region: 705-759
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.25e-23
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 4 Region: 312-369
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.87e-23
Family Classic zinc finger, C2H2 0.0076
Further Details:      
 
Domain Number 5 Region: 368-425
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.02e-22
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 6 Region: 537-594
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.31e-22
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 7 Region: 65-122
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.84e-22
Family Classic zinc finger, C2H2 0.0084
Further Details:      
 
Domain Number 8 Region: 201-257
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.25e-21
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 9 Region: 122-178
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.03e-20
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 10 Region: 650-706
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.13e-19
Family Classic zinc finger, C2H2 0.0086
Further Details:      
 
Domain Number 11 Region: 481-538
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.2e-18
Family Classic zinc finger, C2H2 0.0095
Further Details:      
 
Domain Number 12 Region: 27-79
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.23e-18
Family Classic zinc finger, C2H2 0.0069
Further Details:      
 
Domain Number 13 Region: 410-463
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000212
Family Classic zinc finger, C2H2 0.0086
Further Details:      
 
Domain Number 14 Region: 1-38
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000332
Family Classic zinc finger, C2H2 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000000642   Gene: ENSORLG00000000522   Transcript: ENSORLT00000000642
Sequence length 761
Comment pep:novel chromosome:MEDAKA1:2:15764142:15809782:1 gene:ENSORLG00000000522 transcript:ENSORLT00000000642 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YVCKECGNRFSVWSQFRIHMRVHSGRKTFFCKECDKRFTQISNLKTHVRTHTGEKPFSCK
ECDASFRHVSHLKTHMRTHTGEKPFSCKDCDASFSDFSNLKRHIRTHTGEKPFFCKECAK
RFSQISHLKSHMRTHTRDKPFACKECAKRFTQICNLKKHMTTHTGETPFSCNQCDVSFKS
RPFLDHISAKIKMEVCSLRDFFKLTNLQSHMITHTGEKYFSCKECDRGFSRISNLKTHMR
THTGEKPFSCKECDKSFSRISNLKTHMRTHTGEKPFTCKECNTSFSHISHLKRHMRTHTG
EKPFPCTECDKSFSHIGNLKTHMRTHTGEKPFACKECKTSFSDSSNLKKHMRTHTGEKPF
SCEECNRSFSEKYDLKKHMRTHKGERPFSCEECDKSFSHISSLKAHMRSHTGEKPFSCEE
CNKSFRHISHLYAHMRTHTGENHFPYCKECGKSFGYFSQLKFHMRFHTKGKPFACMKCTQ
SFSKLTNLKSHMRTHTGEKPFSCKECGRSNSRINGLKKHMRTHTGKKSFSCKDCDISFSH
ISHLKRHMRTHTGEKPFSCKGCDKSFSRIYSLKTHMRSHTGEKPFSCKGCDKRFSRIYSL
KAHMRTHTGEKPFSCKECDTSFRDVSNLKRHMRIHTGEKPFSCTECDKRFGQISGLKIHM
RTHTREKPFSCKECDKSFSQGSHLNSHMRIHTGENLFSCAECYISFSRISYLKRHMRTHT
GEKPFPCKECDKSFSRIYNLKTHMRTHTGEKPFSCKECNTS
Download sequence
Identical sequences H2L4F1
8090.ENSORLP00000000642 ENSORLP00000000642 ENSORLP00000000642

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]