SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000000670 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000000670
Domain Number 1 Region: 6-116
Classification Level Classification E-value
Superfamily SRCR-like 9.02e-30
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00079
Further Details:      
 
Domain Number 2 Region: 317-421
Classification Level Classification E-value
Superfamily SRCR-like 1.14e-28
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00077
Further Details:      
 
Domain Number 3 Region: 211-315
Classification Level Classification E-value
Superfamily SRCR-like 5.75e-28
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00093
Further Details:      
 
Domain Number 4 Region: 630-730
Classification Level Classification E-value
Superfamily SRCR-like 4.58e-26
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00091
Further Details:      
 
Domain Number 5 Region: 531-625
Classification Level Classification E-value
Superfamily SRCR-like 7.46e-22
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0031
Further Details:      
 
Domain Number 6 Region: 731-822
Classification Level Classification E-value
Superfamily SRCR-like 1.57e-16
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0053
Further Details:      
 
Domain Number 7 Region: 112-209
Classification Level Classification E-value
Superfamily SRCR-like 0.000000837
Family Scavenger receptor cysteine-rich (SRCR) domain 0.043
Further Details:      
 
Domain Number 8 Region: 421-527
Classification Level Classification E-value
Superfamily SRCR-like 0.00000144
Family Scavenger receptor cysteine-rich (SRCR) domain 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000000670   Gene: ENSORLG00000000544   Transcript: ENSORLT00000000670
Sequence length 823
Comment pep:novel chromosome:MEDAKA1:13:794385:809875:1 gene:ENSORLG00000000544 transcript:ENSORLT00000000670 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NINITCSDSVRLENGSSRCSGRLEVKSNNSWSSVCEDDFDLLDAEVVCRELGCGAPSVLQ
GALYGEAEAPILSREFLCEGHESVLLDCGSSWRKTKACPPDKAVGLTCSDPATVRLMGSS
RCSGELQVKSGGEWRAVDGWRFERTETLPSVCKNLKCGPHVSSTIKKLPREKPVFWISST
CFDKFSLNMDECVYYDTMSSQTLEITCLGSTDSVMLENGSSRCSGRLEVKSNNSWSSVCE
DDFDLLDAEVVCRELGCGAPSVLQGALYGEAEAPILSREFLCEGHESVLLDCGSSWRKTK
ACPPDKAVGLTCSGSTDSVRLENGSSQCSGRLEVKSNNWWSSVCEDDFDLLDAEVVCREL
GCGAPSVLQGALYGEAEAPILSREFLCEGHESVLLDCGSSWRKTKACPPDKAVGLTCSDP
LRLMGSSRCSGELQVKTGGEWRAVDAPIYRIRQETLAYVCKKLKCGSHIASTNKQLPREQ
PVFPVGPFCLDKFPQNIEECVYYDTMSSQTMEITCSGNKPSDADCMYVSLLENGSSRCSG
RLEVKSNNSWSSVCEDDFDLLDAEVVCRELGCGAPSVLQGALYGEAEAPKWNKEFLCKGH
ESSLLPVRLMGSSRCSGNKPSDADCMYVSQLENGSSQCSGRLEVKSNNWWSSVCEDDFDL
LDAEVVCRELGCGAPSVLQGALYGEAEAPILSREFLCEGHESVLLDCGSSWRKTKACPPD
KAVGLTCSGIIRLEGDVSHCAGTLEMFYGGEWGPVAASNWSRDSASAVCAQLGCGSALST
RSKDNFLNRSVWWIQPPCGPSLEDCDIMRWDDQSQSTLEIICS
Download sequence
Identical sequences H2L4H8
ENSORLP00000000670 8090.ENSORLP00000000670 ENSORLP00000000670

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]