SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000000822 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSORLP00000000822
Domain Number - Region: 124-151
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000169
Family Classic zinc finger, C2H2 0.049
Further Details:      
 
Domain Number - Region: 77-130
Classification Level Classification E-value
Superfamily Starch-binding domain-like 0.0222
Family Starch-binding domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000000822   Gene: ENSORLG00000000665   Transcript: ENSORLT00000000822
Sequence length 154
Comment pep:novel chromosome:MEDAKA1:15:2225670:2226131:-1 gene:ENSORLG00000000665 transcript:ENSORLT00000000822 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QLVPKHQERTLKLVAINPSQPVKRPSGDQPVVVLNHPDADIPQVVKIMEVVSRHREVQKV
VLSRRTLDALSASSDKNVPGYAQTQPAWRGDNPVQERFTLKFKFRRLNRKKYEIVGVDSP
SRSLPVKFSCWFCGRSFTCQETMMSHRQRHLMEW
Download sequence
Identical sequences H2L4W8
8090.ENSORLP00000000822 ENSORLP00000000822 ENSORLP00000000822

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]