SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000000911 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000000911
Domain Number 1 Region: 77-122
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000188
Family Classic zinc finger, C2H2 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000000911   Gene: ENSORLG00000000743   Transcript: ENSORLT00000000912
Sequence length 201
Comment pep:known chromosome:MEDAKA1:14:1898609:1903066:-1 gene:ENSORLG00000000743 transcript:ENSORLT00000000912 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASGSGSSKNDFRRKWDKDEYENLAQKRLNEERERELRDGKPVPPVKRELLRHRDYKVDL
ESKLGKTIVITKTTPQAEMGGYYCNVCDCVVKDSINFLDHINGKKHQRNLGMSMRVERSS
LDQVKKRFEVNRKKMEEKQKEYDFEERMKELREEEEKAKAYRKEKQKERKRRAEEDLDLE
DDDEMAAVMGFSGFGSSKKSH
Download sequence
Identical sequences H2L547
XP_004076090.1.28442 8090.ENSORLP00000000911 ENSORLP00000000911 ENSORLP00000000911

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]