SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000000931 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000000931
Domain Number 1 Region: 79-180
Classification Level Classification E-value
Superfamily Ribonuclease H-like 2.28e-22
Family Hermes transposase-like 0.0009
Further Details:      
 
Domain Number 2 Region: 21-65
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000005
Family BED zinc finger 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000000931   Gene: ENSORLG00000000759   Transcript: ENSORLT00000000932
Sequence length 182
Comment pep:novel chromosome:MEDAKA1:13:1920626:1921909:1 gene:ENSORLG00000000759 transcript:ENSORLT00000000932 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSWVCRMEFCLIIDLPRKFPPVWNNFDLVTPNKVKCRLCSTELSYINNSTSSMLRHYRAR
HGNEEFADTRESTPGHILWKTLDLEVAETQKTRNATVDSIIEVQRYLAETNTPRNQDPLQ
YWKLNQEIYPHLHQLALKTLCSPSSSVPCKRVFSKAGELVCKRRNRLGAKRLQKLLFLNK
NS
Download sequence
Identical sequences H2L565
ENSORLP00000000931 8090.ENSORLP00000000931 ENSORLP00000000931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]