SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000000939 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000000939
Domain Number 1 Region: 331-383
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.11e-16
Family Classic zinc finger, C2H2 0.0017
Further Details:      
 
Domain Number 2 Region: 298-346
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000535
Family Classic zinc finger, C2H2 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000000939   Gene: ENSORLG00000000766   Transcript: ENSORLT00000000940
Sequence length 436
Comment pep:novel chromosome:MEDAKA1:14:1972672:1974497:1 gene:ENSORLG00000000766 transcript:ENSORLT00000000940 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAATKAELLLPSLQISEPPASPLDGYSKLEELQMLLQNAAAGGSLLAASAADAAGLLSGE
SGDYGAEKHMCTFKIQGQTEEQPDLFLFSESLLDILDLQNFPPLTPRLQPLAYSGRFIFD
PSSSGCSNLWAEPLLGLLGLGSITAPPSAAGSLTTSTPSVASSTPSQPSLGCSTIDVSSI
LSATPSYTSAAGSDSAHPPTDAFLAPQLYQSQAPPPAYPSSASRLGLQPVMAMLPDYTLP
QQAPDGELSPSPDQKPLQPPFTPLSTIKAFSAQIQPQGPGGLLAKSCQSKKSPGGRQCRT
PPHERPHVCPADGCERRFSRSDELTRHVRVHTGQKPFQCRICMRSFSRSDHLTTHIRTHT
GEKPFPCSECGRKFARSDERKRHAKIHQRQRDRKPDGATATIPEAPASPDSSYSSPAHSC
PAIGIQSYPPPTAPTS
Download sequence
Identical sequences H2L573
8090.ENSORLP00000000939 ENSORLP00000000939 ENSORLP00000000939

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]