SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000000984 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000000984
Domain Number 1 Region: 260-393
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.42e-38
Family variant C2H2 finger 0.011
Further Details:      
 
Domain Number 2 Region: 184-261
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.2e-17
Family Classic zinc finger, C2H2 0.05
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000000984
Domain Number - Region: 141-173
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0714
Family Classic zinc finger, C2H2 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000000984   Gene: ENSORLG00000000804   Transcript: ENSORLT00000000985
Sequence length 427
Comment pep:known chromosome:MEDAKA1:6:1366577:1376525:-1 gene:ENSORLG00000000804 transcript:ENSORLT00000000985 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GDGTILEALSFPEQQADGGLGVQSPGPELLVCLFCSESAPLPQKDSLLKHLLLEHKLVIA
DVRLIANLPKYMLYWKGRFLEQPVADFCSVIKTNSAGPADKQEEYFLLCDVLPEDRTLRE
KLQQKRLEEVLEQQQKERNDCSFHRVCMFCSEEFSGNRSSLLNHMAREHSFSIGLPDNIV
FCSEFLDTLQNKLDNLQCLYCEKEFRDKTTLKDHMRKKAHRRINANNHQYDRFYVINYLE
LGKTWEEVQSEDDRELVEDDEEDDWSDWQANPVSAVCLFCDHQSETMDELYSHMKDAHTF
DLHQLKTELDLRFYQQVKLVNFIRRQIHQSRCYSCQQNFDSKADLMQHLDREAHVMKLPD
TSAWDQPQYYFPTYENDALLCTLSESDEDERGEQTDCGEDVPVIAEDISDLRALKQSSVL
NHLLKHS
Download sequence
Identical sequences H2L5B7
ENSORLP00000000984 8090.ENSORLP00000000984 ENSORLP00000000984

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]