SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000001018 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000001018
Domain Number 1 Region: 209-511
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 1.96e-85
Family Arginine methyltransferase 0.00000000156
Further Details:      
 
Domain Number 2 Region: 31-134
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.74e-28
Family variant C2H2 finger 0.00034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000001018   Gene: ENSORLG00000000829   Transcript: ENSORLT00000001019
Sequence length 517
Comment pep:known chromosome:MEDAKA1:3:5289754:5371533:1 gene:ENSORLG00000000829 transcript:ENSORLT00000001019 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VCGFPSSCKCCIVDSGDEMPELSDGEDDDCEDEEQWQWMEEDAQTVTCLFCDRQLSSVPA
TLQHCTAEHQVSLTEVIRKHGLEDYGYIKMINFIRLTKCGPSCLTGLSEGPLPWESEDFL
KPALQDDLMLQTACPSSRTESYNALLLRAQTAEERACSSEEALSRAMEDLHKLKILSQNL
VLNTDTSKSGNLCAVAELREDEDEAYFSSYGHYGIHEEMLKDKVRTESYRDFMYRNPDVF
RDKVVLDVGCGTGILSMFAARAGATQVIGVDQSDIVYQAMDIIRSNQLEDKITLIKGRIE
DIKLPVAKVDIIISEWMGYFLLFESMLDSVVYARDLYLSDGGSVYPDLCNISLAAVGDKH
KHHDRVAFWDDVYGFNMSCMKKAALPEALVEVVKMDTVISEPTVIQTIDCNRVCLSELEF
TTDFCLRMTKTTVCTAIVGYFDIFFDKDCNNKVMFSTGPQVTKTHWKQTVFLLERPISVQ
AGDELQGKILVRKNKKDPRALWVTIDLRDRKQTYSLQ
Download sequence
Identical sequences H2L5E9
8090.ENSORLP00000001018 ENSORLP00000001018 ENSORLP00000001018

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]