SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000001159 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000001159
Domain Number 1 Region: 324-373
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.52e-16
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 2 Region: 593-643
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000217
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 3 Region: 663-719
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000126
Family Classic zinc finger, C2H2 0.0096
Further Details:      
 
Domain Number 4 Region: 453-511
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000526
Family Classic zinc finger, C2H2 0.062
Further Details:      
 
Domain Number 5 Region: 562-602
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000444
Family Classic zinc finger, C2H2 0.026
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000001159
Domain Number - Region: 49-78
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00244
Family C2HC finger 0.079
Further Details:      
 
Domain Number - Region: 496-557
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00595
Family Classic zinc finger, C2H2 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000001159   Gene: ENSORLG00000000956   Transcript: ENSORLT00000001160
Sequence length 730
Comment pep:novel chromosome:MEDAKA1:7:1424712:1431616:1 gene:ENSORLG00000000956 transcript:ENSORLT00000001160 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQTIFEALEGMDNQTVLAVQSLLDGQGGVNDPNNQNVSAGSTIQSMEDEDVFLCGKCKK
QFNSLPAFMTHKREQCHSGAPSLSTVSLASTNIYAPVPSISSVQQNPANRQVSTYITVPP
SPLTHTLVQGNVLVSDDVLMSAISAFTSIDQPMASMQTPVQSNLSMHTSGVSYLQQQPPL
SLPSSQTAAHSLPAGAPAQQPLSSQVPSSHSSSVVQVYSAMPHMAGGGGGVAEIHSLGLQ
AYHPVQVPSQCGESQSFSSAPIYSPEKQTTKTKTCGAAGNMAELGDFEKVIIPKQPRSAK
KNSSGGSDFKPTAEQLKGKGPKLKCSFCDKTFTKNFDLQQHIRSHTGEKPFQCIVCGRAF
AQKSNVKKHMQTHKVWPMSVASTVSRLPITVKVVPVSANEKEEGEQRVDRNEDSSQQRQS
EQHASENLPGQAQTKQIVLIDSSYQCQFCAGKFRTYFQLKSHLTQHKGEQVYKCVLKSCC
QTFQKLDQFLEHIRTHQEQLTYRCHLCSKVFPSLFELGVHQYSHCFCPQQSTHKEAAVYR
CVKCQSRYSTQEALEEHLLTASHSFPCPHCQKVFPCERYFRRHLPTHGVGGRFKCQICKK
AFKTEHYLKLHARIHSGEKPYKCSLCDATFNRKDKVKRHMLIHEPFKKYKCPFRTHVGCT
KEFNRPDKLKAHILSHSGIKPFKCLFCQKTFSRRAHMLEHQQSHTDNYRFRCSVCNKGFT
RQSYFRDHKC
Download sequence
Identical sequences H2L5S2
ENSORLP00000001159 ENSORLP00000001159 8090.ENSORLP00000001159

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]