SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000001281 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000001281
Domain Number 1 Region: 14-119
Classification Level Classification E-value
Superfamily POZ domain 5.02e-24
Family BTB/POZ domain 0.0011
Further Details:      
 
Domain Number 2 Region: 323-375
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000158
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 3 Region: 291-338
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000135
Family Classic zinc finger, C2H2 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000001281   Gene: ENSORLG00000001040   Transcript: ENSORLT00000001282
Sequence length 384
Comment pep:novel chromosome:MEDAKA1:10:5537728:5540176:1 gene:ENSORLG00000001040 transcript:ENSORLT00000001282 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESFDMPSLKLISATDTLYSAAILKSLDEQRSIGLFCDVTIIVQDKKFRAHKTILSASST
YFHQLFSVAGQVIELNFIRPEIFEQILNYIYSSRIVRVRSDMLEELIQAGQVLGVKFIAN
LGSPLSQVKGIPGLSKETDAKNDGCNEVLPVITESFSISSEEFNQNEKKAGKEEDSDCDV
VFVSRTDAQTRAAGGEVSEVIDLDKLDVENASKVDGNALGKGEPSTPTTNSSHSSSPLVV
SSRSAPSTPAGARSFTPEPSSSSQPFDNTDIMGVHKKQVSTLFQEGDVKHYEVVMDGKTF
FVCVVCKRPYVCLTSLRRHFNTHSWEKKYPCRHCNKVFALAEYRTKHEILHTGERRYQCL
LCNDTFLNYQLLSSHCKQAHNQDP
Download sequence
Identical sequences H2L637
ENSORLP00000001281 ENSORLP00000001281 8090.ENSORLP00000001281

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]