SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000001300 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000001300
Domain Number 1 Region: 32-169
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.88e-16
Family Canonical RBD 0.0065
Further Details:      
 
Domain Number 2 Region: 211-312
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00000000000443
Family Canonical RBD 0.0053
Further Details:      
 
Domain Number 3 Region: 169-203
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.0000942
Family Ran binding protein zinc finger-like 0.0029
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000001300
Domain Number - Region: 635-685
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0131
Family Classic zinc finger, C2H2 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000001300   Gene: ENSORLG00000001053   Transcript: ENSORLT00000001301
Sequence length 812
Comment pep:known chromosome:MEDAKA1:5:1375856:1387203:1 gene:ENSORLG00000001053 transcript:ENSORLT00000001301 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGTDRGLSRGERSGRYGSDGRGDDPEWSRQKEGSSMDDRPRELCDEPREGDSPGVRQQRR
KRKRQSSDQSDDEYDGDFPEQDGKMEMEESNTIMLRGLPPSVTEEDIGKALEELQGPQPV
DIRLMKKRAGISRGFAFVEFYHLQDSTRWMETNQKKLLIQGKSVAVQYSNRRQKFENWLC
NSCGLYNFRKRVKCYRCGTCKTGESPGGNGLNIEAQQAGEIPGDTIILRNIAPTSTVEGI
LTILAPFANLSTSNVRLIKDKQTGQNRGFAFVQLSTPLEASQLLTILQSLQPPLKLDGKT
VGVDFAKSARKDSVQTDVIRANALSVASTAIAAAQWSSSQLPQSSRASASLPEGHAEQTQ
CSCCWRWFTRRYFGISKLNLSPAAPAVKTIIPAAAGVIVPQTAHVYQPALQAAGVCSASP
VTPASATVDTAVCAGPTVNTVGESAVPDPSAYQYDESSGYYYNPHTGLYYDSSSQYYYDC
ETQQYLYWDSETQTYAPAPSEPVSNAESNANGPAGSSTTAAKEPKEKKQKFKNKSAQQIA
KDMERWAKSLNKQKENVRNNNQTFGSCREEDRKESLAADAAFFLFERKVNKVPRLWMIYE
TFVCAVNVKGDADPVRVVESDQEESGMERLEGEEEKLTDWKKLLCLLCRRQFPTKEALLR
HQQLSDLHKQNLDIQKRSKLSETELEDLERKEAELKYRDRAAERREKYGVTEPPAPKRKF
YQASAPVVNYEQPTKDGLTSDNIGSKMLQAMGWQEGRGLGRHQQGITTPIAASLRAKGTG
LGSKGSSYELSPSDTYKDAVRKAMFARFTEIE
Download sequence
Identical sequences H2L656
8090.ENSORLP00000001300 ENSORLP00000001300 ENSORLP00000001300

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]