SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000001433 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000001433
Domain Number 1 Region: 441-485
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000487
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 2 Region: 474-510
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000897
Family Classic zinc finger, C2H2 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000001433   Gene: ENSORLG00000001165   Transcript: ENSORLT00000001434
Sequence length 522
Comment pep:novel chromosome:MEDAKA1:7:2609308:2619012:-1 gene:ENSORLG00000001165 transcript:ENSORLT00000001434 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVDHLSLGEETFLYCSGSPRSDYNCACHHILGVMVTDACSYHHQSYQGVTLFSPPCLSED
DLSDSSSLCSSHCSSPESSSPVSHASYESKSRRSNGCCSSSGGESQESLLDLLLSQGSVT
TSLSSNSGTSSDAMGLDSSAISLTWESKREQRPNVLQQHTKEDVFEFPVFLDELQDPEAL
LFQPTLEEIEEFLEENMVVGVEKEEDGSEEAMSPETSTSDDAEAEGSTTWAGQSSPRNSD
QTVPVTKDVLKKSSDPSEMDSSPSMVDAISADSRVDGIKQEDCGSSSDSSESANASSNVP
VILQIQPIQIKQEPNPNAISDAVTSQPQKTHSQPAQGPSDIKIAQLLVTIQGQTFALVPQ
LLSPAAASSNKIGSAGSSKFVRIAPVPIAAKPTGLGDGSLSGSLAAGVLAGGQRCQKSAV
ADLIKMHKCSFPGCNKMYTKSSHLKAHLRRHTGEKPFACTWPGCGWRFSRSDELSRHRRS
HSGVKPYQCIVCEKKFARSDHLSKHLKVHRFPRSSRTGRSAN
Download sequence
Identical sequences H2L6I3
ENSORLP00000001433 ENSORLP00000001433 8090.ENSORLP00000001433

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]