SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000001443 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000001443
Domain Number 1 Region: 32-285
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3e-92
Family Eukaryotic proteases 0.0004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000001443   Gene: ENSORLG00000001175   Transcript: ENSORLT00000001444
Sequence length 287
Comment pep:novel chromosome:MEDAKA1:8:2256980:2259642:1 gene:ENSORLG00000001175 transcript:ENSORLT00000001444 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QGGGGAMMSVLSQCGAPGKALEREKDQPAAPREQSMPLLPTVCGLANLNTSIVGGQDAPA
GFWPWQVSLQSPSHFCGGSLINNQWVLTAAHCFPRSGSASDVTVVLGLQSLEGSNPNNVS
QTVTTVIVHPNYNSTSSDNDIALLQLSSPVTFNNYISPVCLSATNSTFYSGVNTWVTGWG
NNESGVSLPAPQTLQEVQVPIVGNRQCKCSYGASSITDNMVCAGLLEGGKDSCQGDSGGP
LVIKQNNLWIQAGVVSFGEGCVEPNYPGVYTRVSQYQTWINTQITSN
Download sequence
Identical sequences H2L6J3
8090.ENSORLP00000001443 ENSORLP00000001443 ENSORLP00000001443

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]