SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000001476 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000001476
Domain Number 1 Region: 7-257
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.04e-92
Family Eukaryotic proteases 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000001476   Gene: ENSORLG00000001198   Transcript: ENSORLT00000001477
Sequence length 299
Comment pep:novel chromosome:MEDAKA1:8:2308583:2312343:1 gene:ENSORLG00000001198 transcript:ENSORLT00000001477 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FLLLPFSESVSQLSVCGRANLNNRIVGGQDAPAGFWPWQVSLQGSRHFCGGSLINNQWVL
TAAHCFPSRSASGVTVVLGLQSLQGSNPNRVSRTITTLIVHPNFNSATQNNDIALLQLSS
PVTFTNYITPVCLPSTGSTFYSGVNTWVTGWGTIRSGVSLPAPQTLQEVQIPIVGNRRCK
CSYGASLITDNMMCAGLLAGGKDSCQGDSGGPLVIKQNIRWIQAGIVSFGKGCALPNFPG
IYTRVSQYQTWINTQITTNKPGFIAFTSTGTDSDLSVSSYFLHVGLSLGQRINNFYAFV
Download sequence
Identical sequences H2L6M6
8090.ENSORLP00000001476 ENSORLP00000001476 ENSORLP00000001476

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]