SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000001485 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000001485
Domain Number 1 Region: 9-258
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 4.66e-87
Family Eukaryotic proteases 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000001485   Gene: ENSORLG00000001206   Transcript: ENSORLT00000001486
Sequence length 263
Comment pep:novel chromosome:MEDAKA1:8:2334449:2337649:1 gene:ENSORLG00000001206 transcript:ENSORLT00000001486 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVSSINALFLLHSQMDSSAVCGRANLNNRIVGGQDAPAGFWPWQVSLQTSSHFCGGSLIN
NQWVLTAAHCFPRANQLMNPIDFVCNLILQGSNPNNVSRTITRLIIHPNYNSNDNDIALL
QLSSPVNFTNYISPVCLSATNSTFYSGVNTWVTGWGNIGSGVSLPAPQTLQEVQVPIVGN
RRCKCSYSSITDNMVCAGLLEGGKDSCQGDSGGPLVIKQNNRWIQAGVVSFGRGCALPNF
PGVYTRVSQYQTWINTQIISNQP
Download sequence
Identical sequences H2L6N5
ENSORLP00000001485 8090.ENSORLP00000001485 ENSORLP00000001485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]