SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000001526 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000001526
Domain Number 1 Region: 244-295
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.38e-20
Family Classic zinc finger, C2H2 0.0058
Further Details:      
 
Domain Number 2 Region: 183-239
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.51e-19
Family Classic zinc finger, C2H2 0.021
Further Details:      
 
Domain Number 3 Region: 285-337
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000019
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 4 Region: 128-184
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000157
Family Classic zinc finger, C2H2 0.027
Further Details:      
 
Domain Number 5 Region: 18-71
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000192
Family Classic zinc finger, C2H2 0.021
Further Details:      
 
Domain Number 6 Region: 90-142
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000202
Family Classic zinc finger, C2H2 0.032
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000001526
Domain Number - Region: 5-25
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0293
Family Classic zinc finger, C2H2 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000001526   Gene: ENSORLG00000001242   Transcript: ENSORLT00000001527
Sequence length 353
Comment pep:known chromosome:MEDAKA1:2:16925804:16927424:1 gene:ENSORLG00000001242 transcript:ENSORLT00000001527 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QRVAHKCPQCAKCFIYRSQELLSHQRSHRARPFYRCEHCDKAFHHLSSLTNHKQIHLDQS
RFACSQCNKVFESAERRDAHLTQHELPKLNCSVCKQTFVSQALLLRHLQTHSAEGAVLRY
NCLFCDQSFSGVTLLRIHQRSHTPRTYRCDQCNKSYASLTILQAHQLTHRASARYLCPQC
GKSFKTRHGLECHLRTHSGERPYCCPYCPKDFTAIAGLNVHMRRHTGERPYVCTVCGKGW
PSGGDLQKHMRSHTGERPYVCQYCGKGFSMSCHLTEHRRIHTGEKPYSCPDCGKCLRRKF
DLNKHLLSHSNVRPHTCPLCPKSYTRKTHLSRHLLTHRPAEAGRHVQEESSDI
Download sequence
Identical sequences H2L6S1
8090.ENSORLP00000001526 ENSORLP00000001526 ENSORLP00000001526

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]