SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000001639 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000001639
Domain Number 1 Region: 428-488
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.54e-18
Family Classic zinc finger, C2H2 0.0018
Further Details:      
 
Domain Number 2 Region: 473-535
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000017
Family Classic zinc finger, C2H2 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000001639   Gene: ENSORLG00000001328   Transcript: ENSORLT00000001640
Sequence length 1345
Comment pep:novel chromosome:MEDAKA1:2:17075577:17149747:-1 gene:ENSORLG00000001328 transcript:ENSORLT00000001640 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDGSSFADLPKKAPPSETRAPHHLFPTFHTPIPIDMRHHEGRYHYEPHALHAMHSSAGLS
GTPVISDLSLIRLSPAAMATGDSPFSPPHPYVSPHVEHYLRSVHGSPTLSMISAARGLSP
AELAHEHLKDRGLFGPGASAAEYYHLMASHRSPYSELLAQGATGGAHLSDYISPIDVSRF
SSPRVTPRISRKRALSISPLSDASIDLQTMIRTSPNSLVAYINNSRSSSAASSSYGHLSV
GGLSPTFPFPHHINPMAYQQLLSQQRGLSAFGHTPPLMQPPATFSSRQTSLSLSSTMHNS
NPTSKCTSQKSFILFAQNPGGDPAVSSTGEPMIHKRSKVKSEAEGLRPSSPHSPNQQSSL
LDLKEDVDRDEYKQEPEAVYETNCHWEGCSKEYDTQDQLVHQQTNKCHDEQQYVILYWED
CSREQKPFKAQYMLVVHMRRHTGEKPHKCTFEGCAKAYSRLENLKTHLRSHTGEKPYVCE
HEGCNKAFSNASDRAKHQNRTHSNEKPYVCKIPGCTKRYTDPSSLRKHVKTVHGPEAHVT
KKQRSDLPPRPPGPRENGENEMSGREMLPKEDKVSDHSSPRGVEDYLHVKSIKTENSVMH
QPSPGSQSSCSSEPSPLGTNHDSGVETAAHSGGSLGELSPLDDLPFVESLGLEDFAGGGA
ATVGLHLRKQLGMSQHLQHLKKETLRTVRESCRWASKPTPPILNSKLPPIPAGGSLLENP
GWGDGPAPFPGSGLGELSSGKAARLGRVSERRDSSSSTLSSVYTLSRRSSGISQCFSSRR
SSQTSPFGTNRPSNNSSADSYDPISADISRRSSQTSHCGRSSGGPGGWGGGLPSPLSLTP
AQHYSLKAKYAAATGGAPPTPPPYMEQIALKSHRALFQDPQDSFMNRNWASRQDSISRSL
MPHEVPSSIPRRASDPVRRLDPLSQLNMQRYNSMGTLRGGTAIHPYPPPPEDHRRTSLQG
GMRLDHGLRRYTYSPRPPSILENIPCGTTSTNNRGVVGQLDYQGAPPVPQQVVPQRKTTA
VQLSASSKSPGQQISSSSLQVSSTGPHWGQGPVDDFQRFPKAQPQSNLAVVPQNQNFGPG
VDYFQQSFNLNEDPSAQYRFNAGSYDQNGNTNHSPCANMAASAMPRCKQEPLHTNVAEFQ
SMRVKTDNCDPPNILCNQKNCNTVPHNGVPTFNQNCVRPRPPTEAKAFSGSRILGTSGLT
TGGVSGHRCTPDDNVLYYTGQIQVFEPNENMGCCVSPVENIPSFENSEAASTLTNNQAPV
TPALEHAQIDFDSILDDGDHSSLMSGTLSPGLLPSLSPGSSRLTTPRNSVALPSVQSGTG
NMAIGDMNSLLAALAEENKFLNMIS
Download sequence
Identical sequences H2L731
ENSORLP00000001639 ENSORLP00000001639 8090.ENSORLP00000001639

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]