SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000001756 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000001756
Domain Number 1 Region: 530-582
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.93e-19
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 2 Region: 19-71
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.42e-18
Family Classic zinc finger, C2H2 0.0086
Further Details:      
 
Domain Number 3 Region: 263-315
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.71e-18
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 4 Region: 586-638
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.58e-17
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 5 Region: 369-426
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.62e-17
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 6 Region: 117-175
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000123
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 7 Region: 493-545
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000397
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 8 Region: 301-353
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000538
Family Classic zinc finger, C2H2 0.02
Further Details:      
 
Domain Number 9 Region: 162-220
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000013
Family Classic zinc finger, C2H2 0.018
Further Details:      
 
Domain Number 10 Region: 62-118
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000129
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number 11 Region: 419-471
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000983
Family Classic zinc finger, C2H2 0.018
Further Details:      
 
Domain Number 12 Region: 203-257
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000173
Family Classic zinc finger, C2H2 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000001756   Gene: ENSORLG00000001419   Transcript: ENSORLT00000001757
Sequence length 647
Comment pep:novel chromosome:MEDAKA1:11:3489333:3522263:1 gene:ENSORLG00000001419 transcript:ENSORLT00000001757 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RQMTHSNYYIQHKGTELHHAKQKPFCCSACGKRFSQNSNLKTHMRIHTGEKPFVCSFCNK
RFVQKVHLRYHMVRHTGEKLLGCSTCGQRFNWVYQLKNHRCAHAGEKGFTCSVCCRVFLW
KRQLQRHMGSHAGAPPLSCTACCGKVFGLRDSLMRHLRCHTGEKPFGCSVCGKQFRDRGN
MGQHMVVHTGEKRFSCTSCDQQFCWRGLLTIHTTLHTGEKLSRLLSCSQCGEAFSGQEDL
NLHLKCHSRALKCSICDVGCSDRDALIQHMRIHTRQTQFSCSVCGKDFAWRRHLTKHMRT
HTGEKPFSCEICSKKYTNKASMQSHMSVHNAERKYSCDICKKTFAWFTELKYHQTKLHTG
GRQNKKTSKTCSFCGKTFTSILAQELHVRLHTGEKPYSCHVCGKKFTQKGNLTSHLHVHA
SEKPFKCKACPRAFCHLTSLERHVREHSSAPSYCCKVCNDSFDRKTLLEKHAETHLQDPD
CCCAICGYQYESTDSLISHLRSHRDARSTCDTCGKSFPGYSALLMHLRIHTGEKPFTCSY
CGKAFNQTGNLKTHLKIHTGERAFSCSICGKGFTQKQTLDTHIRFHNKERRFLCQVCGKG
FMQEVDLKRHILIHTGEKPYICSVCGKSFQAKRSLNGHLKGHSAEGK
Download sequence
Identical sequences H2L7E4
ENSORLP00000001756 ENSORLP00000001756 8090.ENSORLP00000001756

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]