SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000001766 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000001766
Domain Number 1 Region: 577-633
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.47e-21
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 2 Region: 674-726
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.09e-20
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 3 Region: 633-689
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.37e-20
Family Classic zinc finger, C2H2 0.0072
Further Details:      
 
Domain Number 4 Region: 341-393
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.95e-20
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 5 Region: 247-298
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.36e-19
Family Classic zinc finger, C2H2 0.0067
Further Details:      
 
Domain Number 6 Region: 412-468
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.64e-18
Family Classic zinc finger, C2H2 0.0094
Further Details:      
 
Domain Number 7 Region: 297-356
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.88e-18
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 8 Region: 538-590
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.01e-16
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 9 Region: 57-113
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000107
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 10 Region: 107-159
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000117
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 11 Region: 181-231
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000128
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 12 Region: 511-549
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000018
Family Classic zinc finger, C2H2 0.021
Further Details:      
 
Domain Number 13 Region: 2-52
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000087
Family Classic zinc finger, C2H2 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000001766   Gene: ENSORLG00000001429   Transcript: ENSORLT00000001767
Sequence length 741
Comment pep:novel chromosome:MEDAKA1:11:3500234:3512407:-1 gene:ENSORLG00000001429 transcript:ENSORLT00000001767 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SHSCRVCGQLFHGRGFLLKHAEKHSSESKCVCGVCGEGLKPGNSLRQHLQSHRDTSRTCN
ICGKKFPSIRAQETHMRLHTGEKPFNCRFCHKGFNQKGNMVTHMKTHTAEKLFACTVCDE
ESSHSSSSERHMKAHEEQMPFSCTVCDEGFQTSAELRRHVQSHNQPTKRAKRRKPSLTPS
HSCKVCGNSFHNKGNLLRHAETHSDDPDFLCGICGERADSLESLQLHLQSHRETSRVCEI
CGVNFRDMEIHMRTHTGQKPFRCKDCGKEFPRKGSLERHMRLHAGERPYICEFCGKTFIE
NTVLKRHIKSHTGGKPRIYPCEVCGKKFTMSQHLDVHKRIHTGEKPYTCRVCNKSFRQIG
NLDSHMRIHTGEKPFICSLCGKRFRQKISLETHERFHKKEKAFICQLCSKGFVQKIDLKR
HMLTHTGEKPFRCEVCGKSYQEKRSLDSHMKVHNGEPTFGCSRCNKVYLKKQLTQKYSKI
HKRKQQITTQEPHSDVNINNALNTIGLNSLNLFRCSECGKTYSSQSYLKLHTQYHAERPY
RCPVCRKCFTWRGRLQKHMRTHTGEKPFKCTVCCKRFSESGNLKVHMRIHTGEKPFSCSF
CGKSYAQRGNLKMHMAMHRGETTYSCSECGKRFGFKGQLASHMRAHTGEKPFRCPVCWKC
FSWNACLQKHMKIHTGEKPYRCTVCGKGFIESGNLKVHMRIHTGEKPFNCSECGKRYRQK
GSLTKHMDVHRELNLLNVTEI
Download sequence
Identical sequences H2L7F4
8090.ENSORLP00000001766 ENSORLP00000001766 ENSORLP00000001766

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]