SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000001925 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000001925
Domain Number 1 Region: 104-162
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.22e-17
Family Classic zinc finger, C2H2 0.0092
Further Details:      
 
Domain Number 2 Region: 156-213
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000497
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 3 Region: 456-505
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000336
Family Classic zinc finger, C2H2 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000001925   Gene: ENSORLG00000001555   Transcript: ENSORLT00000001926
Sequence length 513
Comment pep:known chromosome:MEDAKA1:5:2317931:2325250:-1 gene:ENSORLG00000001555 transcript:ENSORLT00000001926 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDVDDCNGPSYTSASGESSMENEFSGALGGPTVSTPNSKDNSPTRSLSANSIKIELYSDD
DPEVERGERLEDRGTRQRSESGENFRELANPETMPAGAARLPNGKLKCDICGMICIGPNV
LMVHKRSHTGERPFQCNQCGASFTQKGNLLRHIKLHSGEKPFKCPFCSYACRRRDALTGH
LRTHAVSSPTVGKPYKCSYCGRSYKQHSTLEEHRERCQSYLQSLESQLPNNAYTPGEEMR
ELEFIPDSLLQSSSNKMVFIDRLANAVTKRKRSTPQKFVGQKHIRLNPADAPYELSAELD
KDGEMHRGDLDSLYVGGLGGEYPGVAGNSPRMSLRHPASTQLQSPFRQSWSEAGLHRDRS
WGGREAAEGHEDVSAGPSHVPSPSNGCQESTDTESMPGRDRHSLSNAKERDVKNEEGRHS
ALAPPPLAAVPVSLTAHSATSTEALRVVDGEGHVVRSFRCDHCRVIFLDHVMFTIHMGCH
GFRQPFECNICGYRSQDRYEFSSHIVRGEHVFE
Download sequence
Identical sequences C4XVD6
ENSORLP00000001925 NP_001292341.1.28442 8090.ENSORLP00000001925 ENSORLP00000001925

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]