SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000001948 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000001948
Domain Number 1 Region: 1057-1104
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000981
Family Classic zinc finger, C2H2 0.029
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000001948
Domain Number - Region: 625-682
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000437
Family Classic zinc finger, C2H2 0.0083
Further Details:      
 
Domain Number - Region: 468-496
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00119
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number - Region: 749-774
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00119
Family Classic zinc finger, C2H2 0.031
Further Details:      
 
Domain Number - Region: 265-292
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00224
Family Classic zinc finger, C2H2 0.03
Further Details:      
 
Domain Number - Region: 1170-1193
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00745
Family Classic zinc finger, C2H2 0.033
Further Details:      
 
Domain Number - Region: 946-972
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0246
Family Classic zinc finger, C2H2 0.044
Further Details:      
 
Domain Number - Region: 971-1037
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0246
Family Classic zinc finger, C2H2 0.048
Further Details:      
 
Domain Number - Region: 376-401
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.025
Family Classic zinc finger, C2H2 0.038
Further Details:      
 
Domain Number - Region: 524-553
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0654
Family Classic zinc finger, C2H2 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000001948   Gene: ENSORLG00000001571   Transcript: ENSORLT00000001949
Sequence length 1194
Comment pep:novel chromosome:MEDAKA1:9:4024462:4035307:1 gene:ENSORLG00000001571 transcript:ENSORLT00000001949 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PQTDAESTEGSPAKIKMKEVDAKDLSTTKADAYGDPENLFYCETCNYGNPSIKGIQNHQI
KIHRHTINNECVAEYTSMLCDQKEEDKKKLDSHSSDSPSAKVPQTERVLQCYRCDFHTPV
VYLLKKHLLKMHNVNRAYKDIIRLCYRAGSLESGYHCEWCVFSDKTTVAVFEHYREQHPQ
KQINYPYINTKLYAGPKILQTHKKKPKLVETTNYSTSEKKRSDHQRNEKPSSSNQVEDLS
KIPGLFESFQVPLDDTDDQTLSTSEKFKCPSCPQSFRSQSNLSAHCGTEHKDVVDDSTEM
SKSQTQAAMRLQVHVFKCVHCPYINTMYQGVLTHSQMKHPTLIPEMDTLLLDVKNLRNWE
EYTKKKECGETPKVYGYICEKCQRIFVTLKKLKRHCSTIHQSGESNPVQDEDASSPKPHG
NKGSVPTASFLSKKKYGKIRCQHCSYICSTKMALSQHLHIHHKSFAPKGTFKCSLCSHVY
YHKKKLKSHYIKDHDKSAYLKYYLPLCKNLTDLESSPSKASPKEVQRAYKCQLCPHETTC
RKYLRSHYQNTHKLDGITTYKFLEKYNRRKRSYLRMCGAGEKHKYVRGEESFTVKCQQCP
DLVLDSHQLLIEHYSHFHGLGSKLDFKVLSFGVRKGSTGIYKCYHCLTKLYGTRKLHYHL
DRHRAKMVELTKALLKKEPAVDPVASGTQQFPLTHLISVVVYVVKQDKLSPFGNVTELGQ
RKISSVEAVAPSSPVSGANIKVDAEAEKDGHACKQCGRTFMSLSGLHSHEQSHAALAAIE
KLDHLSTSGCCYPNCSAGRMNKYVIHKSGTVKPFLCSCCSYRTTLLGLLRRPFLKNHQGQ
QGYRHRSIDFDQLTVGKRSECLKKKKKRTGKASLLFHPEKNTLKPSSSKNRSTSPKPDVE
PEESEESVYSEPPDVQRQLNHYSLMARNNSEPSDGHSPLKLTKNRQLCCEFCNFHTEHPS
SIRRHYMGRHGKKILRCKDCSFFTGLRKSLEMHIEAGHLTFQPTATYQKDFRCPFCLYQS
KNKNHMIDHIVLHREERVVPIEVHRPKLSRYLQGIVFRCHRCTFTCGSAKSLHFHMMRHS
DLKPYKCRLCYFDCTLLKDLEKHLSDQHQVLRNHELVGQVSLDQLESRIERSPENCKEEE
EEDEEGASSSGQKQAGRGVFTAVNVLNPPRLKCEFCGRSFTDLSELTRHVGRHG
Download sequence
Identical sequences H2L7Y1
ENSORLP00000001948 ENSORLP00000001948 8090.ENSORLP00000001948

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]