SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000001970 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSORLP00000001970
Domain Number - Region: 1-43
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0148
Family HkH motif-containing C2H2 finger 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000001970   Gene: ENSORLG00000001589   Transcript: ENSORLT00000001971
Sequence length 182
Comment pep:novel chromosome:MEDAKA1:9:4045284:4047123:-1 gene:ENSORLG00000001589 transcript:ENSORLT00000001971 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGTHYCNICRQTTFSGKKHIFGKQHQSSLRVVLTKFIEKVKEARRTIKKPQVEKFDCIQH
KQTFWCYCCEAEVEKNVTDDKMTVLYGGLLEHMATKEHKKNTHKFWWDNKADQKLKDKVL
ITEEDMKRFKDEVATVLETFVEEEDDFIKQQAAVIRAQEKHRQEVFESFLEVCFPAMQWQ
YP
Download sequence
Identical sequences H2L802
ENSORLP00000001970 8090.ENSORLP00000001970 ENSORLP00000001970

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]