SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000001973 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000001973
Domain Number 1 Region: 9-66
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.14e-23
Family Classic zinc finger, C2H2 0.0083
Further Details:      
 
Domain Number 2 Region: 121-178
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.69e-23
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 3 Region: 317-373
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.64e-23
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 4 Region: 373-429
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.42e-20
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 5 Region: 163-215
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.16e-20
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 6 Region: 51-103
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.76e-18
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 7 Region: 414-466
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.54e-16
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 8 Region: 265-317
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.23e-16
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 9 Region: 235-277
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000199
Family Classic zinc finger, C2H2 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000001973   Gene: ENSORLG00000001592   Transcript: ENSORLT00000001974
Sequence length 471
Comment pep:novel chromosome:MEDAKA1:9:4048054:4056072:1 gene:ENSORLG00000001592 transcript:ENSORLT00000001974 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YRCETCGKAFPYKSKLIRHQRIHTGVKPYCCNICGKRFNQTSILKVHLRIHTGERPYSCD
TCGKRFNQKSILNVHKKIHSVERPYACDACGKRFFQKASMEAHVIWHTEKHEYKCDTCGK
VFQFRSRLVRHMRIHTGVKPFCCHTCGKRFNQKSILIVHQRIHTGERPYSCDVCGKTFNQ
TSILNVHKRIHTGERPYCCETCGKSFTQKSILNGHKIIHTRETLLLQNMRQKPQKSLKLH
MKTHIKNVENPYKCDTCGKVMSNFKNYKFHMKSHTVEKSYKCETCGKMFRESWDLNKHLV
IHATEKPYKCEICGNGFNRRYNLDLHQRVHTGEKPYKCTVCAKSFSSCVNLKKHQRVHTG
EKPYTCKDCGKEFADSSAFKNHQRVHTGEKPFKCTLCKRKFATRTTLKRHNRTHTGEKPY
ECHVCNKKFGHKSDLKGHLRLHTGEKPYECSLCQEKFSTWLKLHKHKRVHT
Download sequence
Identical sequences H2L805
8090.ENSORLP00000001973 ENSORLP00000001973 ENSORLP00000001973

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]