SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000002014 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000002014
Domain Number 1 Region: 476-661
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.93e-53
Family DBL homology domain (DH-domain) 0.000000122
Further Details:      
 
Domain Number 2 Region: 665-800
Classification Level Classification E-value
Superfamily PH domain-like 5.21e-35
Family Pleckstrin-homology domain (PH domain) 0.00000224
Further Details:      
 
Domain Number 3 Region: 188-299
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000612
Family Spectrin repeat 0.0088
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000002014
Domain Number - Region: 5-79
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.000123
Family CRAL/TRIO domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000002014   Gene: ENSORLG00000001623   Transcript: ENSORLT00000002015
Sequence length 927
Comment pep:novel chromosome:MEDAKA1:10:6446342:6460616:1 gene:ENSORLG00000001623 transcript:ENSORLT00000002015 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLIKASFPGNLHLVLVLRPTSFFHRTVTDIGFRFSQDDFMLKMPVVMLSSVTDLLRYIDE
NQLTSEFGGTLDYCHSDWILLRTAIESFAVTVKDIAQMLQSFGTELAETELPDEGKIIEN
LLETHTEKYRELKDAIRSVSKEGRNLLSSLETTGKQDDAQWDIKLDWETVERLLAQLRDM
ESAFDGFFEKHHLKLHQYLQLLRYEQSFSEMDLCLEHLMNQEKEFSTKVSTLAQTEQALK
RMDSLESNAQEVMSRAQILILHGHQLSAGHHYAMALIMQRCNELRHRCDTLSTALQSKHS
IFLQTHQLLLCLGQVQTWCDEGAYMLANQLVDKSQSKEGAQAALRDIERFLEGAPPNLNS
GPDILTIEYEAVLTPQLQAQISRTFEKHAAVQQMIQNRQACLRKLADKHVRPIQLVAPRP
ENPPRSKSPLFSPKHVKNSVNVGFKVRRRNVVRPPKDSKESRSCVAYSVDGDDSPDLLKR
HVMRELIETERIYVEELLAVLLGYRAEMDNPMLSGLLPPILHSKRDVLFGNMPEIYNFHS
RVFLQELEGCLEAPERVGACFLQRKESFQMYECYCQNKPRSESLWRQFSDCSFFQECQKK
LEHKLGLDSYLLKPIQRLTKYQLLIKELLKYSSDCEGTSELQGALTAMLDLLKSVNDSMH
QISITGYEGDICELGRVLMQGSFSVWISHKRGPTRMKELARFKPMQRHLFLYERALLLCK
RREEHGDGIDKTPSYSFKHCLKMTAVGITENIKGDVRKFEIWYSGREEVYVVQAPSVEVK
MAWLNELRKILTHQQKLLRAASSRDYQSAQKRLNPGRAAQTPNHTPPNTSTTAGVSKPGH
VLLINFTQHVCGSGWPGAHHSVDICEGLEDWSGDQDVFQLTEDTSLVQLSPGRYRALADC
SQNGPDSIIIKCGDMIQLQCEDSRGRW
Download sequence
Identical sequences H2L845
8090.ENSORLP00000002014 ENSORLP00000002014 ENSORLP00000002014

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]