SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000002024 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000002024
Domain Number 1 Region: 407-458
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.35e-17
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 2 Region: 450-502
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000108
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 3 Region: 188-240
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000473
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 4 Region: 366-418
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000143
Family Classic zinc finger, C2H2 0.0084
Further Details:      
 
Domain Number 5 Region: 159-196
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000493
Family Classic zinc finger, C2H2 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000002024   Gene: ENSORLG00000001628   Transcript: ENSORLT00000002025
Sequence length 507
Comment pep:known chromosome:MEDAKA1:2:17888211:17895889:-1 gene:ENSORLG00000001628 transcript:ENSORLT00000002025 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRRKQSNPQPVKLESEDGVVVCEPSCLVLDSDILLSGELEFTETDLIGLDREAGVTVFS
LSVEDDPTAPTDSTFPAILSCKGCGQLLEDTPLAAGLELGVGLALGAELYCLTCEAAVQH
SASIDSFKVDSPDQLNLPPNSTPDKKRRGVAKSEGDIPQKLFSCSLCTFTSRYSNHLKRH
MRIHDGQKPYRCPACPYASAQLVNLQRHTRTHTGEKPYRCVQCSYACSSLGNLRRHQQMH
LQERPKKKEKRQGKRRKSKENTKKKKRKRNFLAPTMSVSAVMSDLTLRVSQDSMYLQTLA
SFSTASGPLPVLLFPLCCRVCGLTLEEADLEGDKEKVCRRCSLDLLPKEGSQSRHSTRRA
SRRSTKLYRCPNCPFLSHYPNHLARHSLTHSEEKPHHCPCCSYSSSHLDNLKRHMRVHTG
EKPYQCPSCSYACGNLANLRRHERIHSGAKPFHCSICGYSCNQSMNLKRHMLRHTGEKPY
ACGECGYTTGHWDNYKRHQRKHGHNTD
Download sequence
Identical sequences H2L854
ENSORLP00000002024 ENSORLP00000002024 8090.ENSORLP00000002024

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]