SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000002038 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000002038
Domain Number 1 Region: 274-326
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000053
Family Classic zinc finger, C2H2 0.009
Further Details:      
 
Domain Number 2 Region: 327-368
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000254
Family Classic zinc finger, C2H2 0.0097
Further Details:      
 
Domain Number 3 Region: 361-387
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000134
Family Classic zinc finger, C2H2 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000002038   Gene: ENSORLG00000001641   Transcript: ENSORLT00000002039
Sequence length 387
Comment pep:novel chromosome:MEDAKA1:10:6734277:6737293:-1 gene:ENSORLG00000001641 transcript:ENSORLT00000002039 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSLSRFSGCPLSCVNPGESNTEPSVVLPPLAGEHMGHPTGSSLKLCPSHNLRDYPETRS
TAFVDHSVSFSDSGYPSHRLEHSPRGIIIGANLSGAGMPPVTDQLASRANQHGGIGRYRD
FAGCRDNRSHAFFTSYQEQAHASADAPRDLGSQMMLGIPGDLLTRSHPYSQTVNPKGNSQ
QIVTQFLGLYKPLNMAIQRGGGDAFLRCSKQTVKHELVCKWSDGQEGAGKLPCSRAFGTM
YELVTHVTVEHVGGPEHAEYVCHWENCPRDRKPFKAKYKLVNHVRVHTGEKPFPCPFHGC
EKVFARSENLKIHKRTHTAVLVSLCACLGEKPFKCEFEGCNRRFANSSDRKKHSHVHSSD
KPYMCKVRGCDKCYTHPSSLRKHMKLH
Download sequence
Identical sequences H2L868
ENSORLP00000002038 ENSORLP00000002038 8090.ENSORLP00000002038

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]