SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000002053 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000002053
Domain Number 1 Region: 286-342
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.15e-20
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 2 Region: 330-384
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000248
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000002053
Domain Number - Region: 245-267
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0299
Family Classic zinc finger, C2H2 0.088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000002053   Gene: ENSORLG00000001654   Transcript: ENSORLT00000002054
Sequence length 446
Comment pep:known chromosome:MEDAKA1:10:6744174:6746540:1 gene:ENSORLG00000001654 transcript:ENSORLT00000002054 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LMTMLLDSGPQFASLGVGGFGTPRHHHDIGNRDPSLGLNPFSDSSHSAAFKISPVAHDIA
SSQTSAFTPQASGYAAALGHSHGGQVGSYGGGAFNSTRDFLFRNRSGESSAPSAQHGIFA
ASAGSLHGPPGISDNPGHLLFPGLHEQGVSHPPSSGHVVNSQMHLGLRGDIFGRPDPYRP
VASPRTDPYGAQLHNYNHPINMNMGMNVPTHHGPGAFFRYMRQPIKQELSCKWIEENQMN
RPKKTCDRTFSTMHEMVTHVSMEHVGGPEQSNHVCFWEDCPREGKSFKAKYKLVNHIRVH
TGEKPFPCPFPGCGKIFARSENLKIHKRTHTGEKPFKCEFDGCDRRFANSSDRKKHMHVH
TSDKPYICKVCDKSYTHPSSLRKHMKVHESQGSESSPAASSGYESSTPPVLVSASTEDPT
KTPPSAVQNTSGHSEGLAPNFNEWYV
Download sequence
Identical sequences H2L883
8090.ENSORLP00000002053 ENSORLP00000002053 ENSORLP00000002053

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]