SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000002108 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSORLP00000002108
Domain Number - Region: 453-478
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0222
Family Classic zinc finger, C2H2 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000002108   Gene: ENSORLG00000001700   Transcript: ENSORLT00000002109
Sequence length 1288
Comment pep:novel chromosome:MEDAKA1:3:9673014:9732552:-1 gene:ENSORLG00000001700 transcript:ENSORLT00000002109 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGTKDGMAAPPSAVAALPDNIRFVSPVSGSQGKESKSKYKRSKNSKDNSSKASAGDVGK
KEATGRTQGEPTGAAATTGAASNNSTSGKNMEKGGKASRGVLSGKKDKESASGKSKKDKT
DGTPIVAIGVTEKDVSQAQVALGNSRNSSFENTQSTDLADANQMGNIALESVGIVPALTA
KTEAEEVENGSSECKALKKVKNEKMESPVSTPAPPPLHLLSTVGSSEIASPCEQIMVRTR
SVAVNTSDVALATEPECLGPCEPGTSVNLEGIVWQETEDGMLVVNVTWRNKTYVGTLLDC
TRHDWAPPRFCESPTSDLEMRNGRGRGKRMRPNSNTPMNDNSNSSDNKGTTTNKTRAASN
SKGRRGSQTPSERRTPPNSNTEDIKASPSSGGKRKTKPASDMEPNSSSEDSKGNKRMRTN
SNSGPTGIPIPSVKTESLPPPLDRSCPSPVLIDCPHPNCNKKYKHINGLKYHQARAHNDD
DIKLDLDGDCEYGEDSTLHPEPGNCNGASISQKGSLSPARSVTPKGRNFEAQSPSPSPGK
FGSKQTKKKISETDLDTGGTPMDGCEDGPCLTDEASNDGIDDKRGSDKSRKAGTKTEKMA
QKNLKSPRPLGPGPTASQQMYSFPPGNSNSSSGLTPMMQGIPKSPQMKGGQPKPPATGDL
AASSSKDKKKKDKKKKDGGKDADSPMPPGKGVKLEEGKLPHSEPCDQGNKGDGLLNGSSD
PHQSRLASIKAEADKIYSFSDNAPSPSIGVASRIDGSGMPQPLTPLHVVNQNGADNSSVK
TNSPAYSDISDAGEDGEGKVEGVKVRTEDQAIRESVKKALFPNQTPNKDSPYYAGYEAYY
SPNYVNPSPGGPHPGAPVTEGQAKIKRDEEQDQGEEKVKIEVQEDRKPDSSAPGQQQQQP
SVIQQRSNMYMQPLYYNQYAYVSPYAYTPDQAYHNHLMNTNPAYRQQYEERQRQMAEQHR
VDKKSEAAMKEREASMKEEWKQKSPMPPCLSKASSQSDLGKMQQPQGKSRESPSEPLKSI
GSIKGEDSKSQQAEGLKIKLTEGGHHGKEDSIQALESRGQAGMEQAMWYRQYPDSQKSQA
EEEHQQQQLRRKDERERKLKDERSRPKDSQGGPKEDCKEAGDPRILSEDHRAMSKDSRTN
PHLQFASSLAQHQGYMPYMHGYPYGQGYDPNHPGYRGMPSVMMQNYPASYLPGGYPFSPY
GNKIAGGEEGSEKSRASPTVTKTATDSKALDILHQHASQYKSKSPTVGDKTPHVDRPRSS
PSQRVMASHHHLGYPLLSGQYDLSYATG
Download sequence
Identical sequences H2L8D7
ENSORLP00000002108 8090.ENSORLP00000002108 ENSORLP00000002108

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]