SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000002119 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000002119
Domain Number 1 Region: 795-844
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000203
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 2 Region: 441-491
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000271
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 3 Region: 833-877
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000624
Family Classic zinc finger, C2H2 0.029
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000002119
Domain Number - Region: 184-211
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0279
Family Plant C2H2 finger (QALGGH zinc finger) 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000002119   Gene: ENSORLG00000001704   Transcript: ENSORLT00000002120
Sequence length 887
Comment pep:novel chromosome:MEDAKA1:15:7763080:7813402:-1 gene:ENSORLG00000001704 transcript:ENSORLT00000002120 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRRKQGKPQHLSKRDFSQRCSEHSEESGSLNGHHPGSAVGRLARLGHDAHPTPEQDLLT
CGQCQATFPLADILLFIEHKRKRCHGPPCLAVGRGLDKPPSPSPGLALTPSPALSCLRSR
RPVEVGVQATLADEDDDRFSTPRGIFPKQEPLPGACRSWNFAIFDVEFLLTSSFFCFITG
KEEPTTYTCTTCKQSYGSAWFLLQHAQNSHGFRIYLESDHGSPLTPRMGGPSSLGGGADL
PSQPPLHGLHLPPDASPFNLLRIPGSGSGGRDSIGPGGGVGTGGGVGGGHHQRFPPTPPL
FSPPPRNHLDPHHLSPEELALAAHHPSAFDRVLRLNPPLPLDPPPTMDFSRRLRELAGNT
SGSTPPLSPSRPSPMQRLLQPFQTGGNGSTGGVGGSKPPYLATPPPLSGSMESPVGSQTT
PSTPLPSAGATSSSNTQMKTKCCEFCGKAFKFQSNLIVHRRSHTGEKPYKCHLCDHACTQ
ASKLKRHMKTHMHKSSSPNTGKSEDGLSTTSSPEPGTSDHMGSASNALKSVVAKLKSEND
RMIRENGEANNSYHFGLTLETARQHESNAGVGSRLGGVAEEGSIPRSLPEVMQGMGLAAS
MQHFSEALNAHKRNAMAQENHLHHHFSRDHHHNRNKCDRDSVLETDRGEEGSVSTVNGRG
ASPNESASVGLSKKLLLGSPSPLSPFTKRIKLEKEFDLPTPTIPNTENVYSQWLAGYAAS
RQLKDPFLNFGDSRQSPFASSSEHSSENGSLRFSTPPGELDGGMSGRSGTGSGGSTPHLG
GPGRPSSKDGRRSDTCEFCGKVFKNCSNLTVHRRSHTGERPYKCELCNYACAQSSKLTRH
MKTHGQVGKDVYKCEICQMPFSVYSTLEKHMKKWHSDRPLSTEIKSE
Download sequence
Identical sequences H2L8E7
ENSORLP00000002119 8090.ENSORLP00000002119 ENSORLP00000002119

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]