SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000002129 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000002129
Domain Number 1 Region: 860-1034
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 1.88e-45
Family RNA editing terminal uridyl transferase 2, RET2, domain 2 0.0066
Further Details:      
 
Domain Number 2 Region: 712-855
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 6.07e-40
Family Poly(A) polymerase, PAP, N-terminal domain 0.026
Further Details:      
 
Domain Number 3 Region: 236-297,335-435
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 1.73e-37
Family RNA editing terminal uridyl transferase 2, RET2, domain 2 0.049
Further Details:      
 
Domain Number 4 Region: 82-268
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 3.5e-22
Family Catalytic subunit of bi-partite nucleotidyltransferase 0.074
Further Details:      
 
Domain Number 5 Region: 1057-1085
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000227
Family Retrovirus zinc finger-like domains 0.0049
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000002129
Domain Number - Region: 671-701
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000124
Family Retrovirus zinc finger-like domains 0.0049
Further Details:      
 
Domain Number - Region: 44-85
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00196
Family Classic zinc finger, C2H2 0.088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000002129   Gene: ENSORLG00000001714   Transcript: ENSORLT00000002130
Sequence length 1101
Comment pep:novel chromosome:MEDAKA1:9:4502713:4513765:-1 gene:ENSORLG00000001714 transcript:ENSORLT00000002130 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AEEDANLVIEESTLSVKELESLQQAEKRLKKDEVYRLVKKSRSNPGALYACALCDFLLDS
LSDAYRHIRDRRHKKRLRERQEEVMLTEIRPPGPEQVGAVTSALEAVVQEHGISDQDVEK
RRCVVSVMQELLQSVLPDIKLRLYGSSCTKFGFKDSDVNIDIECPHMHQPDVLLVVKESL
STCPLFINLEADFHARVPAVICKEKKSSGLVCKVSAGNENAHQTTCYLSALSSREPVLLP
LVMGLRRWARICEVDNAEVGGLPPYAFALMVIYFLQKRKEPLLPTYLNSEIKGFSIGRLS
GYNLTHTKDGCVHWTFTGSSKEPSQPAERSSTKGKVPLVFTAPRPTVEAGRLWIELLRFY
SLEFNMADNVISVRTGTVLSREMKDWPKKRIAVEDPFAVKRNMARSVNSQQTCDYILHCL
KTTYKYFASPLSLPSANHKKEAKQETAPGSDVRNLDEEFLDLSSFSLLTLQSLHTSQQCE
VQNGPEDSDCIIEEEEDVEECSDSDEEGEKEKVDMGKSSLSEDEEDEDVGHRRHHLDSVT
TEDEEIFAVDEPSGEELLSDEEGSEYGTPASMEEDEEDVELAPGRPSTAPVQVKNERPEN
THQKQVTFVYKFTRQAFTRGKVKMSPLSSEDKNVDGLLKKDFWHLTNQKDPFTSLINQMS
PFMFDVCLLRRQGSFGSHVVVCSLCKRDGHLKKDCPEDFKKVELHPLPPLTSEFVRVLDR
VCEQCYKDFAPDELELSIRELILQQLEAFVRCQFAGARLQLFGSSKNGFGFRQSDLDICM
VLEGKENIDDVDCIRIIESLARCLKKNPDLKNILPITTAKVPIVKFYHINTSLEGDISLY
NTLALHNTHLLASYAAIDRRVKILCYVMKVFAKMCDIGDASRGSLSSYAYTLMVLFFLQQ
RNPPVIPVLQEIYFGKHKPEVLVDGWNVYFFDDLKTLPSHWPQHGKNTESIGELWLGLLR
FYTEDFDFKEHVVSIRQRARLTTFSKQWTSKYIVIEDPFDLNHNLGAGLSRKTTVTNFIM
KAFINGRTLFGTPFQVLPSIYPSHMEYFFDPEVLTEGQVAPNDRCCRICGKVGHFMKDCS
MRQKSRQKRDSEERPENLDGD
Download sequence
Identical sequences H2L8F7
ENSORLP00000002129 ENSORLP00000002129 8090.ENSORLP00000002129

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]