SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000002163 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000002163
Domain Number 1 Region: 180-376
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 6.02e-48
Family DBL homology domain (DH-domain) 0.000000148
Further Details:      
 
Domain Number 2 Region: 369-488
Classification Level Classification E-value
Superfamily PH domain-like 1.8e-27
Family Pleckstrin-homology domain (PH domain) 0.0000264
Further Details:      
 
Domain Number 3 Region: 113-179
Classification Level Classification E-value
Superfamily SH3-domain 5.51e-24
Family SH3-domain 0.0000596
Further Details:      
 
Domain Number 4 Region: 6-69
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.0000000142
Family Calponin-homology domain, CH-domain 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000002163   Gene: ENSORLG00000001738   Transcript: ENSORLT00000002164
Sequence length 785
Comment pep:novel chromosome:MEDAKA1:10:6842563:6870118:1 gene:ENSORLG00000001738 transcript:ENSORLT00000002164 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLGAYQEPRTEAECISNIREFLRGCSSLKVEGFEPEWLYTGENFGKVLATLMAFNFATQE
SGFGLRTGVTRRPKKSESSNASLKNPEQHAKTYRLHLPQNKSLEMSENGGGGQLMVKARF
NFKQNNEDELSFNKGEVILVTRQEEGGWWEGSLNGKTGWFPSNYVREVKPCEKPLSPKGT
PLTKNYYMVVVQDILEHEREFVKELQTVLTCYLRPLQACDKLPSADSATLCGNLEEILTF
QQDLCSALDDCTKVPEGQQRVAACYLNLMPQIKNLYLTYCSSHPSAVCILTDHSEELDKF
MESQGASSPGILNLTTSLSKPFMRLDKYPTLLQELERHVEEAHPDYTDILKATAAFRSLV
AQCQDLRKRKNLEIQILSEPVRGWEGDSMRSLGQVSYMSQVHMRNGGSEEKEERYLMLFP
NLLVMLSASPRMSGFIFQGKLSLAGTTVTRHVEEEAFDITGGMMERITVFCSSAQDLQEW
LEHLQPFTKGGSPGSTITKVRTPTHPKQRNLQSVDVKPPSMVGAPTPVSHPGSFSAASRG
PLEPPKTSKPWSLSCLRPAPPLKPSAALGYKEDSKSPRPMKKFLPGNRKKERKPSDDEFQ
MRKTRSLPDKDFKANWGFQMYFTSSFEEAQRNGRHEDRRCRGKPSIADDRHSKLITLQNC
PSLVSTGMAALEEDAQILRVIEAYCTGVSLQTATVRKECVPQVLLPEEEKIIVEEMKSNG
QTVTEEKSLVDAVYALKDEVHELKKENKWMKQFLEEEQKSRKELERLVRKLSKQKNDCAW
EDGGH
Download sequence
Identical sequences H2L8J0
ENSORLP00000002163 8090.ENSORLP00000002163 ENSORLP00000002163

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]