SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000002235 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000002235
Domain Number 1 Region: 400-457
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.74e-23
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 2 Region: 90-147
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.92e-23
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 3 Region: 34-91
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.33e-22
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 4 Region: 288-345
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.97e-22
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 5 Region: 345-401
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.9e-22
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 6 Region: 147-203
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.69e-20
Family Classic zinc finger, C2H2 0.008
Further Details:      
 
Domain Number 7 Region: 250-302
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.71e-18
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 8 Region: 2-48
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000027
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 9 Region: 188-235
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000121
Family Classic zinc finger, C2H2 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000002235   Gene: ENSORLG00000001796   Transcript: ENSORLT00000002236
Sequence length 472
Comment pep:novel chromosome:MEDAKA1:2:18369866:18445054:1 gene:ENSORLG00000001796 transcript:ENSORLT00000002236 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KECGKSFIWWSQFRIHMRTHTGEKPFSCKECHTSFSLLSHLKTHMRTHTGEKPFSCKECD
KRFSQTFGLKRHMRTHTGEKPFSCKVCDSSFSEIYNLKAHMRSHTGEKPFSCKECDKSYS
RLSDLKRHKRTHTGEKPFTCNECNRRFCEKSHLKRHISTHTGEKPFSCKECPKSFRHKTH
LTAHIRTHTGEKPFSCKVCDTSFSQMSSLKRHMRTHTGDKSFTFQKIHSYYTYIQSHVVC
HSKRNKSDKRPHVCEECGKSFSYWSKFRLHMRSHTGEKPFSCQECETSFKTKSSLKVHMK
THTGEKPFSCKECDKCFCEKSHLKRHMRIHTGEKPFSCQECDTRFSRISSLKTHIIIHTG
EKPFSCKECNKSFREKSHLKRHMRTHTGEKPFCCQECDTSFSLKSHLETHMRTHTGEKPF
SCQACDKSFSQISHLKRHLRTHTGEKPFSCQECDASFSQISHLKRHMTTHTG
Download sequence
Identical sequences H2L8Q6
ENSORLP00000002235 ENSORLP00000002235 8090.ENSORLP00000002235

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]