SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000002322 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000002322
Domain Number 1 Region: 776-826
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000184
Family Homeodomain 0.02
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000002322
Domain Number - Region: 482-521
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0893
Family Classic zinc finger, C2H2 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000002322   Gene: ENSORLG00000001864   Transcript: ENSORLT00000002323
Sequence length 870
Comment pep:known chromosome:MEDAKA1:7:4386993:4395042:-1 gene:ENSORLG00000001864 transcript:ENSORLT00000002323 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFQLPVNNLSSLRKARKNVKKVLGDIGLEFCKDHLEDFKDFTPPEVYIKHTSWEDVCMWE
PSHTKVQDYRSKPFCCSGCLFSSKYFSAYKSHFRNVHSENFENNILLNCPYCTFNGNKKT
LETHIKLFHMPNNAARQTPGGMVAGTGGVMMKDGLLRRTGDTVEQAVYYCKKCTYRDPLY
NVVRKHIYREHFQQVAHPYIVRPGEKAGAQNGGTLGGPETNNATSNQIHCKKCLFVPRTY
EALVQHVIEDHERIGYQVTAMIGHTSVIIPRPKPIVMFPPKSQGDKTIIGMGPKGAVMAS
TRSPVSLQQGRSSIPSKMGFSSSSLLSGLKHDAMGLKARMSQPFCLGNQNTKVTLPGNAQ
VSVPQQSHAAKQLIPGGSLRSPLVAGASSSLKSNPLGSRVQAAATTVASVTAKKGGSSVL
GTSYTQKWKICTICNELFPENVYSSHFEKEHKAEKVPAVANYIMKIHNFTSKCLYCNRYL
PSDTLLNHMLIHGLSCPHCRATFNDVEKMVAHMRLSHPDEKVGPRTDSPLTFDLTLQQGN
PKNVQLIVTTYNMKDAPEESVAFHAQNTISASSVLSASLMASKRLMPQQPPKALSGHADH
SGVKSTPQTSVPYKRDVGKTLCPLCFSILKGPISDSLAHHLRERHQVIQTVHPVEKKLTY
KCIHCLGVYTSNMTASTITLHLVHCRGVGKAQNGQDSRSVQSSHISQSQSSGVKRAAFDS
SDASAPKRRRPGPPGERAHPRDCNGPSAFVEDPDEPIVLALDPKGLENQSYESRKAFLTE
YFNKAPYPTQQEVEKLASNLWLWKSDVSSHFVSNRRKCVQECESQKANVLLGFSMYELSK
VTHELAFVGEGVYECSLDCASEDQNKTISS
Download sequence
Identical sequences H2L8Y9
ENSORLP00000002322 ENSORLP00000002322 8090.ENSORLP00000002322

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]