SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000002400 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000002400
Domain Number 1 Region: 2-123
Classification Level Classification E-value
Superfamily POZ domain 8.63e-25
Family BTB/POZ domain 0.0015
Further Details:      
 
Domain Number 2 Region: 341-391
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000077
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 3 Region: 287-336
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000102
Family Classic zinc finger, C2H2 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000002400   Gene: ENSORLG00000001928   Transcript: ENSORLT00000002401
Sequence length 413
Comment pep:novel chromosome:MEDAKA1:11:4393634:4400302:1 gene:ENSORLG00000001928 transcript:ENSORLT00000002401 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METVCFRLPGHGDTTLKHMNSLRCRQHFCDITIMANNNQTFKGHKVVLAACSPFLRDQFL
LNPSPKLQVSMLYSSSVVCDLLQSCYTGFLQFSSEEIVSYLTAASYFQMEHIVELCRGAL
EKYVQLKSRSSQKVCVGDDRRGGREQTSQSAEGNDSSKSAQGSSLHHDDGLDDACIKVIT
SDEEGESRQQDFDVYRVYVSEEERMNRDADQEGLKAAESYMSVEIPRLDLNMSDGGEKVS
PAADNGQYALEEPSAGEGSSGLTAVGTNEGGDESVAVVGSTSSVVGPVICEHCGMTFPSA
HSLAVHSRATHLLYACPCCGKHFQHSSNLTRHMAVHRGGSKTHQCPLCYKTFTQKSTLID
HMNLHSGERPHHCAYCHARFAHKPALRRHLKEQHGKTTGQNSLHEQEERERAI
Download sequence
Identical sequences H2L963
ENSORLP00000002400 8090.ENSORLP00000002400 ENSORLP00000002400

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]