SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000002575 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000002575
Domain Number 1 Region: 830-1066
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.71e-54
Family DBL homology domain (DH-domain) 0.0000251
Further Details:      
 
Domain Number 2 Region: 1064-1193
Classification Level Classification E-value
Superfamily PH domain-like 1.7e-36
Family Pleckstrin-homology domain (PH domain) 0.0007
Further Details:      
 
Domain Number 3 Region: 644-699
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000000000174
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.006
Further Details:      
 
Domain Number 4 Region: 158-220
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000000249
Family Ankyrin repeat 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000002575   Gene: ENSORLG00000002064   Transcript: ENSORLT00000002576
Sequence length 1552
Comment pep:novel chromosome:MEDAKA1:9:5090445:5130950:-1 gene:ENSORLG00000002064 transcript:ENSORLT00000002576 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FKGSVFDLPLQGEAKVFALLEGLDSVPEDVEVYIVLDGSTLVHVTRAENDVMLCFIVPGH
NLPEMVSVQAYLCSDNMPLTWAGESSLEYVSDDAQEMAEHLVVHGHCLSSTDHKELSSLF
GLSQESSRWAVDRRVALAMANLDFPSQWNVLGTHSGNDCSPRESPLHLAVRWGLYRLAEL
LLCQPGGLMAVNLPNEEGVTPLQLAQKAGSTQLLKLLLEPPNPLATPPAGLSQVWVDQSR
LLRFCHDTGNLTLTARQNPRWSAPQSRRAHILILRHRLRDMDFLKEVMKKSAVTQKLPSF
YSEDIDEPLMFCLNEDPQGEKNDRRPMIQMGNGRVRCQQLSRFAFDQSLWNKESQASSPT
LAAVARLSAMMHGQDRVYANAMLVDQVDDADIRYRPPVFNGISSKTSLRSSKNKLAIKSC
RHHQTENVSKIRQPDIRLIFGCLKKMVTVTYTTPSVSSSVNVNLSCNLAHHNLCTCVFLC
VTSPSLECDSGDEDILGHSYPCSSIKHRSILHSISGEERGSFDASPDFNRSHSDITPKTI
KNSEDPEVRLRSYSYSSPKAKPSRPLLNRDMAITDLEEEQRAFSLTETPREKRIEDEEWD
KYIIPSKVETEKYKVSRTFSFLKNRMSSTRNKTKVKGKDMKEGKDRTGAMNGHQFVPVSQ
STPALCAACDKPVSGKELLQCSSCFVNVHKNCRESVAACGKTFAQKYYSKNSPNFLLCLM
KLQQERNAALVKSKTTSLPHKLPDSVKENCQASVFSSSSSSPSSTSSREKRETITHFSKS
LSMSLDSSSDDVLFVSRGLSDVAEADTSVDTVDASVLTELSADQLGLDAESWSLAVSPDF
CRKLDRFTIKRQDVIYELMQTELHHIQTLTVMSEVFRRGMLEELQLDLDCVARIFPCLDP
LLLFHRNLFRTLQERRQVSSHQENSQNYLIHQIGDILLQQFSDENAERMKQLYGEFCSHH
MEAVHVFKELQQQNKKLQNFVRQQSNNSLVRRREVPEFILLVTQRITKYPVLLERILQHT
QEGSQEHLDLSNALAQIRDIIAAVDLTVNNYEKCQELQEVLARLDIKSFAKLKNGKVFRK
QDLHSKHRNLQHKGLVFWKTATGRLKDTLALLLTDVLVFLQEKDQRFIFASVDQKPPVIP
LQKLIVREVANEERGMFLISASSAGPEMYEVHTTTREERNAWMKHIRQAVESCPEEEEEE
ERNTETEEARHAAEVRIQKINKFQDALFRQDQRICHSLEEKLQLYAEFAELTLPSPEPSP
HRHLLVQPAQLSDCETPRQALNLVTAALREGQKAAAWVHGSQTQNGFSTQSQSPPAGGPD
CCSYSSHGGSVQESPSEHYLNTLSMSSTSLGSDSESAGLDNVSWSPASEFRKGDKGTLLK
VAESVQNMTQLLYSLQAAVTFQDSCYEVYKLLLLKGEKYQLRNFASLQNNLVPTINHSYF
LKKYVFLLTKEVQKLHAKLKQEQLRWDKECLAREKQQTEQESVLEQREQQCFLEMERLRC
EREQLEAQLLEYQQNLDRLKEGQRTVELERKKIETQQRLLQSWRHSRQSSLP
Download sequence
Identical sequences H2L9N1
ENSORLP00000002575 ENSORLP00000002575 8090.ENSORLP00000002575

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]