SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000002595 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000002595
Domain Number 1 Region: 347-399
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.92e-16
Family Classic zinc finger, C2H2 0.0017
Further Details:      
 
Domain Number 2 Region: 311-357
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000272
Family Classic zinc finger, C2H2 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000002595   Gene: ENSORLG00000002082   Transcript: ENSORLT00000002596
Sequence length 409
Comment pep:novel chromosome:MEDAKA1:15:9694052:9695366:1 gene:ENSORLG00000002082 transcript:ENSORLT00000002596 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RMAAKALDEVAASLRSIIDAIPKDAYAVEGGPTPQTAVVFKEEPAGEEDDERPNEAGGER
LSATGAHLCLVRDRLQLHSDLAQYVATLRAHPVAFSGKFSVDSRCAGGQWTPGDVCVLSA
DITTAGPEAVSGSPAASPGIYAPGGGGEAQSSMAHGQPGISHMYGPPHPHPHSDPPYSCG
GDMYQDQTAGAYLAPSTCAGPYHQHQPYNSAPKPPVDGALLSIIPEYGGFYQQSCQRDIQ
AAFPDRKSLAYPLESLRVAPPLTPLNTIRNFTLAAPSSAAEGPMAAAFPAHQNLPLRPIL
RPRKYPNRPSKTPVHQRPYPCPAESCDRRFSRSDELSRHLRIHTGHKPFQCRICMRNFSR
SDHLTTHIRTHTGEKPFSCQQCGRKFARSDERRRHMKIHLRQKEKKACA
Download sequence
Identical sequences H2L9Q1
ENSORLP00000002595 8090.ENSORLP00000002595 ENSORLP00000002595

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]