SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000002644 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000002644
Domain Number 1 Region: 512-564
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000281
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 2 Region: 551-597
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000108
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 3 Region: 12-126
Classification Level Classification E-value
Superfamily SET domain 0.0000018
Family Viral histone H3 Lysine 27 Methyltransferase 0.073
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000002644
Domain Number - Region: 146-173
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00106
Family C2HC finger 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000002644   Gene: ENSORLG00000002129   Transcript: ENSORLT00000002645
Sequence length 635
Comment pep:novel chromosome:MEDAKA1:16:639071:643788:-1 gene:ENSORLG00000002129 transcript:ENSORLT00000002645 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQANRASTTVSVFADCSIPAGLRIGPVPGICKLGKYVSDRKEVGPKKKVLTMLLTFLQIR
LVRGEFADESGCAVPDWIGFIRPARNSQEQNLEAVTDLPGGQELKIFYRVLREIPAGEEL
LVWYSNALAQWYDIPVTATPTHDEKGEERYICWYCWRIFKYPNTLKAHVHFHCALSNGRS
FVSSELVRGTENFSRSPKSGDIPSASTSPRSAHNNSSVSDSGRRVVSSSPFLNKTGLSRK
SSSEEQDRALDMSVASARTQGPLLSLGATSSVLGGMGFHPGVRSAFKPTGVSKASGSETS
REEANGKLSGLGFSKLIGNTKPIRNLSEGLNVGGTHPSKCAPAIVDSASPMVPCANAIRG
FPLLPHLEESSAFKHVDSRIHPGLSPSRYPQMNPGLHFERFSLPPFDGVKTYGGDCNIPL
MPFTVYNGELLYSSPYYPLKFHFSNLLKYQESMSYFGAPSLSQDLGSITNIDREIAMHTQ
QLSEIAAEKNRSRLDSLPAGSASSGASGKPKKGHLCLYCGKLYSRKYGLKIHMRTHTGYK
PLKCKVCFRPFGDPSNLNKHIRLHAEGNTPYRCDFCGKVLVRRRDLERHVKSRHPGQTVK
KLEDKPGGLFEDAEQKSDNDSDVDVCFTDDQSDQE
Download sequence
Identical sequences H2L9U6
ENSORLP00000002644 8090.ENSORLP00000002644 ENSORLP00000002644

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]