SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000002678 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000002678
Domain Number 1 Region: 545-760
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.88e-51
Family DBL homology domain (DH-domain) 0.00031
Further Details:      
 
Domain Number 2 Region: 233-377
Classification Level Classification E-value
Superfamily PH domain-like 1.69e-43
Family Third domain of FERM 0.00059
Further Details:      
 
Domain Number 3 Region: 896-1039
Classification Level Classification E-value
Superfamily PH domain-like 1.96e-34
Family Pleckstrin-homology domain (PH domain) 0.002
Further Details:      
 
Domain Number 4 Region: 745-867
Classification Level Classification E-value
Superfamily PH domain-like 1.59e-31
Family Pleckstrin-homology domain (PH domain) 0.014
Further Details:      
 
Domain Number 5 Region: 132-235
Classification Level Classification E-value
Superfamily Second domain of FERM 7.07e-27
Family Second domain of FERM 0.0000807
Further Details:      
 
Domain Number 6 Region: 52-132
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.34e-18
Family First domain of FERM 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000002678   Gene: ENSORLG00000002154   Transcript: ENSORLT00000002679
Sequence length 1069
Comment pep:known chromosome:MEDAKA1:4:4666589:4707118:-1 gene:ENSORLG00000002154 transcript:ENSORLT00000002679 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGEIEGSYRVLQTPGTRLGAQFNAGISTLEAGQSLSGNMVSGSKSPGRGLQVRVKGLDDS
QEFFDIDPKAFGQTLLTKVFLRGNLMESDYFGLEFQNMQMMWVWLEPTKPIAKQVRKPAN
TLFRLSVKFFPPDPGQLQEEYTRYLFSLQMKRDLMEGRLICSENTGALLASHLVQSEIGD
YDDVADRDFLKANSLLPYQDKVQEIIMELHRRHLGQTPAESDFQILEIARKLEMYGVRFH
PAADREGTKINLAVAHMGLQVFQGHTKINTFNWSKIRKLSFKRKRFLIKLHPEVHGPHQD
ILEFLMASRDQCKVFWKICVEYHSFFRLFDQPQPKSKAILFTRGSSFRYSGRTQKQLVDY
VRENGPKRTPYQRRNSKIGMSTRSYTTDVPKQHLSFNDSLRGAGSPLSAAAAPFHPAHTS
SVLPRASPPKEDPVKAASPPHYSFQGAPSIQAAGGGRNGGFSSPVPQPAGPGTGRPPWVL
AYTVVESPQLSPLTSKEPLCMSPSFQMSTLSLPSQAPSPLQSPLLSEVGSNARLEEEEEG
RRKRYPTDKAYFIAKEILTTERTYLKDLEVITVWFRSAVIKENAMPEGLMTLLFSNIDPI
YEFHRGFLKELDQRLALWEGRSNAHVKGDYQRIGDVMLKNMCALKEFTSFLQKHDEVLTE
LEKASKRLKKLEMVYKEFELQKVCYLPLNTFLLKPIQRLMHYKLILERLCKHYSPAHRDF
DDCKKALKEVAEIATQLQSSLIRLENFQKLTELQRDLIGIENLTAPGREFIREGCLYKLT
KKGLQQRMFFLFSDMLLYTSKGVTATNQFKVHGQLPLQGMIVEESENEWSVPHCFTIYSA
QRTIVVAASSKVEMGKWIEDLNMAIDLAKKSQEKSSFFLDAGFGDRSNRSSDEVSLEQES
EDDMSSSHTSLDKQTHHRANTTMHVCWHRNTSVSMSDHSLAVENQLSGYLLRKFKNSNGW
QKLWVVFTNFCLFFYKTHQDDFPLASLPLLGYTVSTPEESDGIHKEYVFKLQFKSHVYFF
RAESEYTFERWMEVIKSAASTTGRMSLLIPKGGAVEIGFNGLFSRGNDN
Download sequence
Identical sequences H2L9X8
ENSORLP00000002678 8090.ENSORLP00000002678 ENSORLP00000002678

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]